PA2G4 anticorps (C-Term)
-
- Antigène Voir toutes PA2G4 Anticorps
- PA2G4 (Proliferation-Associated 2G4, 38kDa (PA2G4))
-
Épitope
- AA 138-178, C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PA2G4 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Proliferation-associated protein 2G4(PA2G4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- RKADVIKAAH LCAEAALRLV KPGNQNTQVT EAWNKVAHSF N
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Proliferation-associated protein 2G4(PA2G4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: proliferation-associated 2G4
Protein Name: Proliferation-associated protein 2G4 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human EBP1 (138-178aa RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product PA2G4 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- PA2G4 (Proliferation-Associated 2G4, 38kDa (PA2G4))
- Autre désignation
- PA2G4 (PA2G4 Produits)
- Synonymes
- anticorps EBP1, anticorps HG4-1, anticorps p38-2G4, anticorps Ebp1, anticorps pa2g4, anticorps si:dz150i12.2, anticorps wu:fb19b11, anticorps wu:ft56d05, anticorps zgc:86732, anticorps ebp1, anticorps hg4-1, anticorps p38-2g4, anticorps pa2g4-a, anticorps PA2G4, anticorps DKFZp469G2132, anticorps Pa2g4, anticorps MGC81621, anticorps 38kDa, anticorps AA672939, anticorps Plfap, anticorps proliferation-associated 2G4, anticorps proliferation-associated 2G4, a, anticorps proliferation-associated 2G4, 38kDa, anticorps proliferation-associated 2G4 L homeolog, anticorps proliferation-associated protein 2G4, anticorps proliferation-associated 2G4 S homeolog, anticorps proliferation-associated protein 2G4 pseudogene, anticorps PA2G4, anticorps Pa2g4, anticorps pa2g4a, anticorps pa2g4.L, anticorps pa2g4, anticorps LOC100519773, anticorps pa2g4.S, anticorps LOC693641
- Sujet
-
Proliferation-associated protein 2G4 (PA2G4), also known as ErbB3-binding protein 1 (EBP1), is a protein that in humans is encoded by the PA2G4 gene. This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional corepressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases.
Synonyms: hG4 1 | hG4-1 | Mpp1 | p38 2G4 | Pa2g4 | Plfap | Q9UQ80 - ID gène
- 5036
- Pathways
- Myometrial Relaxation and Contraction, Regulation of Carbohydrate Metabolic Process, Hepatitis C, Toll-Like Receptors Cascades
-