PML anticorps (N-Term)
-
- Antigène Voir toutes PML Anticorps
- PML (Promyelocytic Leukemia (PML))
-
Épitope
- AA 141-179, N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PML est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Protein PML(PML) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- FECEQLLCAK CFEAHQWFLK HEARPLAELR NQSVREFLD
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Protein PML(PML) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: promyelocytic leukemia
Protein Name: Protein PML - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human PML Protein (141-179aa FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLD), different from the related mouse sequence by eight amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product PML Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- PML (Promyelocytic Leukemia (PML))
- Autre désignation
- PML (PML Produits)
- Synonymes
- anticorps MYL, anticorps PP8675, anticorps RNF71, anticorps TRIM19, anticorps 1200009E24Rik, anticorps AI661194, anticorps Trim19, anticorps RGD1562602, anticorps PML, anticorps promyelocytic leukemia, anticorps PML, anticorps Pml
- Sujet
-
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions, all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.
Synonyms: MYL | Pml | PP8675 | Protein PML | RNF 71 | TRIM 19 | P29590 - ID gène
- 5371
- UniProt
- P29590
- Pathways
- Signalisation p53, Retinoic Acid Receptor Signaling Pathway, Maintenance of Protein Location, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus
-