PSMA2 anticorps (Middle Region)
-
- Antigène Voir toutes PSMA2 Anticorps
- PSMA2 (Proteasome Subunit alpha 2 (PSMA2))
-
Épitope
- AA 82-123, Middle Region
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PSMA2 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-2(PSMA2) detection. Tested with WB in Human,Rat.
- Séquence
- DYRVLVHRAR KLAQQYYLVY QEPIPTAQLV QRVASVMQEY T
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-2(PSMA2) detection. Tested with WB in Human,Rat.
Gene Name: proteasome subunit alpha 2
Protein Name: Proteasome subunit alpha type-2 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence in the middle region of human PSMA2 (82-123aa DYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYT Q), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product PSMA2 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- PSMA2 (Proteasome Subunit alpha 2 (PSMA2))
- Autre désignation
- PSMA2 (PSMA2 Produits)
- Synonymes
- anticorps Lmpc3, anticorps wu:faa49c06, anticorps wu:fb98h03, anticorps zgc:110710, anticorps HC3, anticorps MU, anticorps PMSA2, anticorps PSC2, anticorps proteasome (prosome, macropain) subunit, alpha type 2, anticorps proteasome subunit alpha 2, anticorps proteasome subunit alpha 2 L homeolog, anticorps Psma2, anticorps psma2, anticorps psma2.L, anticorps PSMA2
- Sujet
-
Proteasome subunit alpha type-2 is a protein that in humans is encoded by the PSMA2 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit.
Synonyms: HC3 | MU | PMSA2 | PSC2 | PSC3 | PSMA 2 | PSMA2 | P25787 - ID gène
- 5683
- UniProt
- P25787
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-