PSMA4 anticorps (Middle Region)
-
- Antigène Voir toutes PSMA4 Anticorps
- PSMA4 (Proteasome Subunit alpha 4 (PSMA4))
-
Épitope
- AA 84-123, Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PSMA4 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-4(PSMA4) detection. Tested with WB in Human,Mouse,Rat.
- Séquence
- NVLTNELRLI AQRYLLQYQE PIPCEQLVTA LCDIKQAYTQ
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-4(PSMA4) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: proteasome subunit alpha 4
Protein Name: Proteasome subunit alpha type-4 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence in the middle region of human PSMA4 (84-123aa NVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQ), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product PSMA4 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- PSMA4 (Proteasome Subunit alpha 4 (PSMA4))
- Autre désignation
- PSMA4 (PSMA4 Produits)
- Synonymes
- anticorps wu:fe05d10, anticorps zgc:56176, anticorps DDBDRAFT_0204055, anticorps DDBDRAFT_0214953, anticorps DDB_0204055, anticorps DDB_0214953, anticorps C9, anticorps HC9, anticorps HsT17706, anticorps PSC9, anticorps proteasome subunit alpha 4, anticorps proteasome subunit alpha 4 S homeolog, anticorps proteasome subunit alpha type 4, anticorps 20S proteasome subunit alpha-4, anticorps proteasome (prosome, macropain) subunit, alpha type 4, anticorps psma4, anticorps psma4.S, anticorps PSMA4, anticorps CNF01860, anticorps psmA4, anticorps Psma4
- Sujet
-
Proteasome subunit alpha type-4, also known as macropain subunit C9, proteasome component C9, and 20S proteasome subunit alpha-3, is a protein that in humans is encoded by the PSMA4 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Synonyms: HC9 | Macropain subunit C9 | PSC9 | PSMA 4 | psmA4 | P25789 - ID gène
- 5685
- UniProt
- P25789
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-