SAFB anticorps (C-Term)
-
- Antigène Voir toutes SAFB Anticorps
- SAFB (Scaffold Attachment Factor B (SAFB))
-
Épitope
- AA 715-754, C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SAFB est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Scaffold attachment factor B1(SAFB) detection. Tested with WB in Human.
- Séquence
- DLDRRDDAYW PEAKRAALDE RYHSDFNRQD RFHDFDHRDR
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Scaffold attachment factor B1(SAFB) detection. Tested with WB in Human.
Gene Name: scaffold attachment factor B
Protein Name: Scaffold attachment factor B1 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human SAFB (715-754aa DLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDR), different from the related mouse and rat sequences by five amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product SAFB Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- SAFB (Scaffold Attachment Factor B (SAFB))
- Autre désignation
- SAFB (SAFB Produits)
- Synonymes
- anticorps HAP, anticorps HET, anticorps SAF-B1, anticorps SAFB1, anticorps 3110021E02Rik, anticorps 5330423C17Rik, anticorps AU018122, anticorps D18386, anticorps E130307D12, anticorps zgc:55387, anticorps wu:fb40a03, anticorps wu:fd42g06, anticorps SAFB2, anticorps SAFB, anticorps scaffold attachment factor B, anticorps scaffold attachment factor B S homeolog, anticorps SAFB-like transcription modulator, anticorps Scaffold attachment factor B, anticorps SAFB, anticorps Safb, anticorps safb, anticorps safb.S, anticorps LOC5570070, anticorps CpipJ_CPIJ017179, anticorps Bm1_49330, anticorps LOAG_00080
- Sujet
-
Scaffold attachment factor B, also known as SAFB, is a gene with homologs that have been studied in humans and mice. This gene encodes a DNA-binding protein which has high specificity for scaffold or matrix attachment region DNA elements (S/MAR DNA). This protein is thought to be involved in attaching the base of chromatin loops to the nuclear matrix but there is conflicting evidence as to whether this protein is a component of chromatin or a nuclear matrix protein. Scaffold attachment factors are a specific subset of nuclear matrix proteins (NMP) that specifically bind to S/MAR. The encoded protein is thought to serve as a molecular base to assemble a 'transcriptosome complex' in the vicinity of actively transcribed genes. It is involved in the regulation of heat shock protein 27 transcription, can act as an estrogen receptor co-repressor and is a candidate for breast tumorigenesis. This gene is arranged head-to-head with a similar gene whose product has the same functions. Multiple transcript variants encoding different isoforms have been found for this gene.
Synonyms: HAP | HET | SAF B | SAF-B | SAF-B1 | SAFB 1 | SAFB | SAFB1 | Q15424 - ID gène
- 6294
- UniProt
- Q15424
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway
-