SCTR anticorps (C-Term)
-
- Antigène Voir toutes SCTR Anticorps
- SCTR (Secretin Receptor (SCTR))
-
Épitope
- AA 398-440, C-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SCTR est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Secretin receptor(SCTR) detection. Tested with WB in Human,Rat.
- Séquence
- EVQKKWQQWH LREFPLHPVA SFSNSTKASH LEQSQGTCRT SII
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Secretin receptor(SCTR) detection. Tested with WB in Human,Rat.
Gene Name: secretin receptor
Protein Name: Secretin receptor - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human SCTR (398-440aa EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII).
- Isotype
- IgG
- Top Product
- Discover our top product SCTR Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- SCTR (Secretin Receptor (SCTR))
- Autre désignation
- SCTR (SCTR Produits)
- Synonymes
- anticorps SR, anticorps 6530402O03Rik, anticorps SEC-R, anticorps secretin receptor, anticorps SCTR, anticorps Sctr
- Sujet
-
Human secretin receptor (gene name SCTR) is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism. The SCTR gene is mapped to chromosome 2q14.1 by fluorescence in situ hybridization.
Synonyms: SCT-R | SCTR | Secretin receptor | SR | P47872 - ID gène
- 6344
- UniProt
- P47872
-