ST7 anticorps (Middle Region)
-
- Antigène Voir toutes ST7 Anticorps
- ST7 (Suppression of Tumorigenicity 7 (ST7))
-
Épitope
- AA 268-309, Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ST7 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Suppressor of tumorigenicity 7 protein(ST7) detection. Tested with WB in Human.
- Séquence
- DGCYRRSQQL QHHGSQYEAQ HRRDTNVLVY IKRRLAMCAR RL
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Suppressor of tumorigenicity 7 protein(ST7) detection. Tested with WB in Human.
Gene Name: suppression of tumorigenicity 7
Protein Name: Suppressor of tumorigenicity 7 protein - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence in the middle region of human ST7 (268-309aa DGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKRRLAMCARRL), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product ST7 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- ST7 (Suppression of Tumorigenicity 7 (ST7))
- Autre désignation
- ST7 (ST7 Produits)
- Synonymes
- anticorps ETS7q, anticorps FAM4A, anticorps FAM4A1, anticorps HELG, anticorps RAY1, anticorps SEN4, anticorps TSG7, anticorps 9430001H04Rik, anticorps Fam4a2, anticorps suppression of tumorigenicity 7, anticorps ST7, anticorps St7
- Sujet
-
Suppressor of tumorigenicity protein 7 is a protein that in humans is encoded by the ST7 gene. The gene for this product maps to a region on chromosome 7 identified as an autism-susceptibility locus. Mutation screening of the entire coding region in autistic individuals failed to identify phenotype-specific variants, suggesting that coding mutations for this gene are unlikely to be involved in the etiology of autism. The function of this gene product has not been determined. Transcript variants encoding different isoforms of this protein have been described.
Synonyms: ETS7q | FAM4A | FAM4A1 | HELG | RAY1 | SEN4 | ST7 | TSG7 | Q9NRC1 - ID gène
- 7982
-