TGFBR1 anticorps (N-Term)
-
- Antigène Voir toutes TGFBR1 Anticorps
- TGFBR1 (Transforming Growth Factor, beta Receptor 1 (TGFBR1))
-
Épitope
- AA 149-186, N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TGFBR1 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for TGF-beta receptor type-1(TGFBR1) detection. Tested with WB in Human,Mouse,Rat.
- Séquence
- HNRTVIHHRV PNEEDPSLDR PFISEGTTLK DLIYDMTT
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for TGF-beta receptor type-1(TGFBR1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: transforming growth factor, beta receptor 1
Protein Name: TGF-beta receptor type-1 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR1 (149-186aa HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product TGFBR1 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Different localization and expression of protein kinase C-beta in kidney cortex of diabetic nephropathy mice and its role in telmisartan treatment." dans: American journal of translational research, Vol. 7, Issue 6, pp. 1116-25, (2015) (PubMed).
: "[Effect of interferon-α on rat liver fibrosis induced by CCl(4)]." dans: Zhong nan da xue xue bao. Yi xue ban = Journal of Central South University. Medical sciences, Vol. 36, Issue 3, pp. 243-8, (2012) (PubMed).
: "The expression of AT1 receptor on hepatic stellate cells in rat fibrosis induced by CCl4." dans: Chinese medical journal, Vol. 114, Issue 6, pp. 583-7, (2002) (PubMed).
: "
-
Different localization and expression of protein kinase C-beta in kidney cortex of diabetic nephropathy mice and its role in telmisartan treatment." dans: American journal of translational research, Vol. 7, Issue 6, pp. 1116-25, (2015) (PubMed).
-
- Antigène
- TGFBR1 (Transforming Growth Factor, beta Receptor 1 (TGFBR1))
- Autre désignation
- TGFBR1 (TGFBR1 Produits)
- Synonymes
- anticorps AAT5, anticorps ACVRLK4, anticorps ALK-5, anticorps ALK5, anticorps LDS1A, anticorps LDS2A, anticorps MSSE, anticorps SKR4, anticorps TGFR-1, anticorps aat5, anticorps acvrlk4, anticorps alk-5, anticorps alk5, anticorps lds1a, anticorps lds2a, anticorps skr4, anticorps tgfr-1, anticorps TGFBR1, anticorps x-trr1, anticorps AU017191, anticorps Alk-5, anticorps TbetaR-I, anticorps TbetaRI, anticorps Alk5, anticorps Skr4, anticorps Tgfr-1, anticorps tbetaR-I, anticorps tgfbr1, anticorps zgc:123263, anticorps transforming growth factor beta receptor 1, anticorps transforming growth factor beta receptor I, anticorps transforming growth factor beta receptor I S homeolog, anticorps transforming growth factor, beta receptor I, anticorps transforming growth factor, beta receptor 1, anticorps transforming growth factor, beta receptor 1 a, anticorps TGFBR1, anticorps tgfbr1, anticorps tgfbr1.S, anticorps Tgfbr1, anticorps tgfbr1a
- Sujet
-
Transforming growth factor, beta receptor I is a TGF beta receptor. TGFBR1 is its human gene. The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). TGFB1 regulates cell cycle progression by a unique signaling mechanism that involves its binding to TGFBR2 and activation of TGFBR1. Both are transmembrane serine/threonine receptor kinases. The TGFBR1 receptor may be inactivated in many of the cases of human tumor cells refractory to TGFB-mediated cell cycle arrest.
Synonyms: AAT5 | ALK 5 | ALK5 | ALK-5 | MSSE | SKR 4 | SKR4 | TbetaR I | TbetaR-I | tgf b receptor i | TGF beta Receptor I | TGF beta receptor type 1 | TGF beta receptor type I | TGF beta type I receptor | TGF-beta receptor type I | TGF-beta receptor type-1 | TGF-beta type I receptor | TGFBR 1 | TGFBR1 protein | TGFR 1 | TGFR1 | TGFR-1 | P36897 - ID gène
- 7046
- UniProt
- P36897
- Pathways
- Growth Factor Binding
-