HPSE anticorps
-
- Antigène Voir toutes HPSE Anticorps
- HPSE (Heparanase (HPSE))
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HPSE est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity
- Immunogène
- Amino acids NGRTATKEDFLNPDVLDIFISSVQKVFQVVE of human Heparanase 1 were used as the immunogen for the Heparanase 1 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product HPSE Anticorps primaire
-
-
- Indications d'application
- Optimal dilution of the Heparanase 1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the Heparanase 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- HPSE (Heparanase (HPSE))
- Autre désignation
- Heparanase 1 (HPSE Produits)
- Synonymes
- anticorps im:7144134, anticorps hpa, anticorps hpa1, anticorps hpr1, anticorps hpse1, anticorps hse1, anticorps HPSE, anticorps HPA, anticorps HPA1, anticorps HPR1, anticorps HPSE1, anticorps HSE1, anticorps Hpa, anticorps Hpr1, anticorps Hep, anticorps heparanase, anticorps HPSE, anticorps hpse, anticorps Hpse
- Sujet
- Heparanase, also known as HPSE, is an enzyme that acts both at the cell-surface and within the extracellular matrix to degrade polymeric heparan sulfate molecules into shorter chain length oligosaccharides. Heparanase is an endo-beta-D-glucuronidase capable of cleaving heparan sulfate and has been implicated in inflammation and tumor angiogenesis and metastasis. The successful penetration of the endothelial cell layer that lines the interior surface of blood vessels is an important process in the formation of blood borne tumour metastases. Heparan sulfate proteoglycans are major constituents of this layer and it has been shown that increased metastatic potential corresponds with increased heparanase activity for a number of cell lines.
- UniProt
- Q9Y251
- Pathways
- Glycosaminoglycan Metabolic Process
-