HRAS anticorps
-
- Antigène Voir toutes HRAS Anticorps
- HRAS (HRas proto-oncogene, GTPase (HRAS))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HRAS est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity
- Immunogène
- Amino acids KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSY of human HRAS were used as the immunogen for the HRAS antibody.
- Isotype
- IgG
- Top Product
- Discover our top product HRAS Anticorps primaire
-
-
- Indications d'application
- Optimal dilution of the HRAS antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the HRAS antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- HRAS (HRas proto-oncogene, GTPase (HRAS))
- Autre désignation
- HRAS (HRAS Produits)
- Synonymes
- anticorps C-BAS/HAS, anticorps C-H-RAS, anticorps C-HA-RAS1, anticorps CTLO, anticorps H-RASIDX, anticorps HAMSV, anticorps HRAS1, anticorps K-RAS, anticorps N-RAS, anticorps RASH1, anticorps hras, anticorps zgc:110250, anticorps HRAS, anticorps H-RAS, anticorps c-H-ras, anticorps H-Ras, anticorps K-Ras, anticorps hras1, anticorps rash1, anticorps ras, anticorps N-Ras, anticorps c-bas/has, anticorps H-ras, anticorps Ha-ras, anticorps Harvey-ras, anticorps Hras-1, anticorps Kras2, anticorps c-Ha-ras, anticorps c-rasHa, anticorps hrasl, anticorps zgc:110734, anticorps HRas proto-oncogene, GTPase, anticorps v-Ha-ras Harvey rat sarcoma viral oncogene homolog a, anticorps neuroblastoma RAS viral (v-ras) oncogene homolog pseudogene, anticorps Harvey rat sarcoma viral oncogene homolog L homeolog, anticorps Harvey rat sarcoma viral oncogene homolog, anticorps Harvey rat sarcoma virus oncogene, anticorps NRAS proto-oncogene, GTPase, anticorps -Ha-ras Harvey rat sarcoma viral oncogene homolog b, anticorps HRAS, anticorps hrasa, anticorps LOC733587, anticorps Hras, anticorps hras.L, anticorps hras, anticorps NRAS, anticorps hrasb
- Sujet
- GTPase HRas, also known as transforming protein p21, is an enzyme that in humans is encoded by the HRAS gene. This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene.
- UniProt
- P01112
- Pathways
- Signalisation p53, Signalisation MAPK, Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Hepatitis C, Autophagy, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, Regulation of long-term Neuronal Synaptic Plasticity, VEGF Signaling, BCR Signaling
-