Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

IKZF1 anticorps

IKZF1 Reactivité: Humain, Souris, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN4951433
  • Antigène Voir toutes IKZF1 Anticorps
    IKZF1 (IKAROS Family Zinc Finger 1 (Ikaros) (IKZF1))
    Reactivité
    • 59
    • 43
    • 17
    • 5
    • 5
    • 4
    • 4
    • 4
    • 4
    • 1
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 61
    • 15
    • 2
    Lapin
    Clonalité
    • 62
    • 16
    Polyclonal
    Conjugué
    • 39
    • 5
    • 5
    • 5
    • 4
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp IKZF1 est non-conjugé
    Application
    • 61
    • 25
    • 23
    • 19
    • 13
    • 13
    • 10
    • 8
    • 7
    • 4
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purification
    Antigen affinity
    Immunogène
    Amino acids LKEEHRAYDLLRAASENSQDALRVVSTSGEQM of human IKZF1 were used as the immunogen for the IKAROS antibody.
    Isotype
    IgG
    Top Product
    Discover our top product IKZF1 Anticorps primaire
  • Indications d'application
    Optimal dilution of the IKAROS antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
    Restrictions
    For Research Use only
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Stock
    -20 °C
    Stockage commentaire
    After reconstitution, the IKAROS antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Antigène
    IKZF1 (IKAROS Family Zinc Finger 1 (Ikaros) (IKZF1))
    Autre désignation
    IKAROS / IKZF1 (IKZF1 Produits)
    Synonymes
    anticorps Hs.54452, anticorps IK1, anticorps IKAROS, anticorps LYF1, anticorps PRO0758, anticorps ZNFN1A1, anticorps hIk-1, anticorps RGD1562979, anticorps ikaros, anticorps znfn1a1, anticorps ik1, anticorps lyf1, anticorps hik-1, anticorps pro0758, anticorps hs.54452, anticorps MGC108252, anticorps 5832432G11Rik, anticorps Ikaros, anticorps LyF-1, anticorps Zfpn1a1, anticorps Znfn1a1, anticorps hlk-1, anticorps mKIAA4227, anticorps ikzf1, anticorps IKAROS family zinc finger 1, anticorps IKAROS family zinc finger 1 (Ikaros), anticorps IKZF1, anticorps Ikzf1, anticorps ikzf1
    Sujet
    DNA-binding protein Ikaros is a protein that in humans is encoded by the IKZF1 gene. This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions as a regulator of lymphocyte differentiation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. Most isoforms share a common C-terminal domain, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, and for interactions with other proteins. The isoforms, however, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, resulting in members with and without DNA-binding properties. Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes. The non-DNA-binding isoforms are largely found in the cytoplasm, and are thought to function as dominant-negative factors.
    UniProt
    Q13422
    Pathways
    Production of Molecular Mediator of Immune Response
Vous êtes ici:
Support technique