PAX2A anticorps
-
- Antigène Voir toutes PAX2A Anticorps
- PAX2A (Paired Box Gene 2a (PAX2A))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PAX2A est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity
- Immunogène
- Amino acids RKHLRADTFTQQQLEALDRVFERPSYPDVFQASEH of human PAX2 were used as the immunogen for the PAX2 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product PAX2A Anticorps primaire
-
-
- Indications d'application
- Optimal dilution of the PAX2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the PAX2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- PAX2A (Paired Box Gene 2a (PAX2A))
- Autre désignation
- PAX2 (PAX2A Produits)
- Synonymes
- anticorps PAPRS, anticorps Opdc, anticorps Pax-2, anticorps Pax-2a, anticorps XPax-2, anticorps XPax2, anticorps pax-2, anticorps pax2, anticorps xPax-2a, anticorps PAXZF-B, anticorps cb378, anticorps noi, anticorps pax-b, anticorps pax2.1, anticorps pax2a1, anticorps pax[zf-b], anticorps paxb, anticorps pax2.2, anticorps paired box 2, anticorps paired box 2 L homeolog, anticorps paired box 2a, anticorps paired box 2b, anticorps PAX2, anticorps Pax2, anticorps pax2.L, anticorps pax2a, anticorps pax2b
- Sujet
- The PAX2 gene encodes Paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.
- UniProt
- Q02962
- Pathways
- Carbohydrate Homeostasis, Stem Cell Maintenance, Tube Formation
-