FZD10 anticorps

N° du produit ABIN5516677

Détail du produit anti-FZD10 anticorps

Antigène: FZD10 (Frizzled Family Receptor 10 (FZD10))

Reactivité: Humain, Souris, Porc, Boeuf (Vache), Chien, Cheval

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FZD10 est non-conjugé

Application: Immunofluorescence (IF)

Séquence: GMWIWTSKTL QSWQQVCSRR LKKKSRRKPA SVITSGGIYK KAQHPQKTHH

Homologie: Cow: 92%, Dog: 92%, Horse: 92%, Human: 100%, Mouse: 92%, Pig: 100%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Liquid

Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: -20 °C

Stockage commentaire: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Détails sur FZD10

Antigène: FZD10 (Frizzled Family Receptor 10 (FZD10))

Autre désignation: FZD10 (FZD10 Produits)

Synonymes: anticorps CD350, anticorps FZ-10, anticorps Fz10, anticorps FzE7, anticorps hFz10, anticorps cFz-10, anticorps Fz-10, anticorps Xfr9, anticorps Xfz10, anticorps frizzled-10, anticorps frizzled10, anticorps fz10, anticorps fze7, anticorps hfz10, anticorps fk48e04, anticorps fz4, anticorps fzb, anticorps wu:fk48e04, anticorps zg04, anticorps Xfz10A, anticorps fzd10a, anticorps Xfz10B, anticorps Xfz9, anticorps fzd10b, anticorps fzd9, anticorps frizzled class receptor 10, anticorps frizzled class receptor 10 L homeolog, anticorps frizzled class receptor 10 S homeolog, anticorps FZD10, anticorps fzd10, anticorps Fzd10, anticorps fzd10.L, anticorps fzd10.S

Sujet: This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.

Alias Symbols: Fz10, FzE7, CD350, FZ-10, hFz10,

Protein Size: 581

ID gène: 11211

NCBI Accession: NM_007197, NP_009128

UniProt: Q9ULW2

Pathways: Signalisation WNT