ABCA4 anticorps (C-Term)
-
- Antigène Voir toutes ABCA4 Anticorps
- ABCA4 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 4 (ABCA4))
-
Épitope
- AA 1890-1927, C-Term
-
Reactivité
- Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ABCA4 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Retinal-specific ATP-binding cassette transporter(ABCA4) detection. Tested with WB in Human,Mouse,Rat.
- Séquence
- FLLTLLVQRH FFLSQWIAEP TKEPIVDEDD DVAEERQR
- Réactivité croisée (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Attributs du produit
-
Rabbit IgG polyclonal antibody for Retinal-specific ATP-binding cassette transporter(ABCA4) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: ATP-binding cassette, sub-family A (ABC1), member 4
Protein Name: Retinal-specific ATP-binding cassette transporter - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human ABCA4 (1890-1927aa FLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQR), different from the related mouse sequence by eight amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product ABCA4 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- ABCA4 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 4 (ABCA4))
- Autre désignation
- ABCA4 (ABCA4 Produits)
- Synonymes
- anticorps ABC10, anticorps ABCR, anticorps ARMD2, anticorps CORD3, anticorps FFM, anticorps RMP, anticorps RP19, anticorps STGD, anticorps STGD1, anticorps AW050280, anticorps Abc10, anticorps Abcr, anticorps D430003I15Rik, anticorps RmP, anticorps abcr, anticorps ffm, anticorps rmp, anticorps rp19, anticorps stgd, anticorps abc10, anticorps armd2, anticorps cord3, anticorps stgd1, anticorps zgc:91823, anticorps ATP binding cassette subfamily A member 4, anticorps ATP-binding cassette, sub-family A (ABC1), member 4, anticorps ATP binding cassette subfamily A member 4 L homeolog, anticorps ATP-binding cassette, sub-family A (ABC1), member 4a, anticorps ABCA4, anticorps Abca4, anticorps abca4, anticorps abca4.L, anticorps abca4a
- Sujet
-
ABCA4 (ATP-Binding Cassette, Subfamily A, Member 4), also known as ABCR, is a protein which in humans is encoded by the ABCA4 gene. ABCA4 is a member of the ATP-binding cassette transporter gene sub-family A (ABC1) found exclusively in multicellular eukaryotes. Using a whole genome radiation hybrid panel, this gene is mapped to 1p21-p13. And this gene is expressed exclusively in retina photoreceptor cells, indicating the gene product mediates transport of an essental molecule across the photoreceptor cell membrane. Additionally, it is showed by immunofluorescence microscopy and Western blot analysis that ABCR is present in foveal and peripheral cone, as well as rod, photoreceptors. The results suggested that the loss in central vision experienced by patients with Stargardt macular dystrophy arises directly from ABCR-mediated foveal cone degeneration.
Synonyms: ABCA 4 | ABCA4 | ABCR | ARMD 2 | ARMD2 | ATP binding cassette 10 | CORD3 | FFM | P78363 | Photoreceptor rim protein | RIM ABC transporter | RIM protein | RmP | RP19 | Stargardt disease protein | STGD | STGD1 - ID gène
- 24
- UniProt
- P78363
-