ADAM2 anticorps (N-Term)
-
- Antigène Voir toutes ADAM2 Anticorps
- ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))
-
Épitope
- AA 231-274, N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ADAM2 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Disintegrin and metalloproteinase domain-containing protein 2(ADAM2) detection. Tested with WB in Human,Mouse,Rat.
- Séquence
- WIDENKIATT GEANELLHTF LRWKTSYLVL RPHDVAFLLV YREK
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Disintegrin and metalloproteinase domain-containing protein 2(ADAM2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: ADAM metallopeptidase domain 2
Protein Name: Disintegrin and metalloproteinase domain-containing protein 2 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM2 (231-274aa WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK), different from the related mouse and rat sequences by eleven amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product ADAM2 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))
- Autre désignation
- ADAM2 (ADAM2 Produits)
- Synonymes
- anticorps AI323749, anticorps Ftnb, anticorps Ph30-beta, anticorps CRYN1, anticorps CRYN2, anticorps CT15, anticorps FTNB, anticorps PH-30b, anticorps PH30, anticorps PH30-beta, anticorps PH-30, anticorps a disintegrin and metallopeptidase domain 2, anticorps ADAM metallopeptidase domain 2, anticorps Adam2, anticorps ADAM2
- Sujet
-
ADAM2 (A Disintegrin and Metalloproteinase Domain 2), also known as FTNB or PH30, is an enzyme that in humans is encoded by the ADAM2 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. This gene is mapped to 8p11.2.
Synonyms: ADAM2 | CT15 | Fertilin beta | Fertilin subunit beta | Ftnb | PH30 | PH-30 | Ph30 beta | PH30-beta | Q99965 - ID gène
- 2515
- UniProt
- Q99965
-