ALOX12 anticorps (N-Term)
-
- Antigène Voir toutes ALOX12 Anticorps
- ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))
-
Épitope
- AA 186-231, N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ALOX12 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Arachidonate 12-lipoxygenase, 12S-type(ALOX12) detection. Tested with WB in Human,Mouse,Rat.
- Séquence
- ALKRVYTLLS SWNCLEDFDQ IFWGQKSALA EKVRQCWQDD ELFSYQ
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Arachidonate 12-lipoxygenase, 12S-type(ALOX12) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: arachidonate 12-lipoxygenase
Protein Name: Arachidonate 12-lipoxygenase, 12S-type - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human 12 Lipoxygenase (186-231aa ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product ALOX12 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))
- Autre désignation
- ALOX12 (ALOX12 Produits)
- Synonymes
- anticorps 15-LOX-1, anticorps 15LOX-1, anticorps 12-LOX, anticorps 12S-LOX, anticorps LOG12, anticorps ALOX12, anticorps ALOX15, anticorps 9930022G08Rik, anticorps Alox12p, anticorps P-12LO, anticorps 12-LO, anticorps zgc:64120, anticorps wu:fb72a11, anticorps arachidonate 15-lipoxygenase, anticorps arachidonate 12-lipoxygenase, 12S type, anticorps arachidonate 12-lipoxygenase, anticorps arachidonate 12-lipoxygenase, 12S-type, anticorps ALOX15, anticorps ALOX12, anticorps Alox12, anticorps alox12, anticorps LOC100072916
- Sujet
-
ALOX12, Arachidonate 12-lipoxygenase, is an enzyme that in humans is encoded by the ALOX12 gene. By fluorescence in situ hybridization, the ALOX12 gene is located in band 17p13.1. The gene consists of 14 exons with 13 introns and spans approximately 15 kb of DNA Arachidonate 12-lipoxygenase introduces a molecular oxygen into the C-12 position of arachidonic acid to produce 12(S)-hydroperoxy-5,8,10,14-eicosatetraenoic acid. The major pathway of arachidonic acid metabolism in human platelets proceeds via a 12-lipoxygenase enzyme. Expression of the LOG12 gene was detected in human erythroleukemia cells, platelets, and human umbilical vein endothelial cells by reverse transcription-PCR analysis.
Synonyms: 12 Lipoxygenase | ALOX12 | arachidonate 12-lipoxygenase | EC1.13.11.31 | Lipoxin synthase 12-LO | LOG12 | P18054 | Platelet-type lipoxygenase 12 - ID gène
- 239
- UniProt
- P18054
- Pathways
- Positive Regulation of Endopeptidase Activity
-