ANGPTL2 anticorps (Middle Region)

N° du produit ABIN5518733

Détail du produit anti-ANGPTL2 anticorps

Antigène: ANGPTL2 (Angiopoietin-Like 2 (ANGPTL2))

Épitope: AA 275-312, Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANGPTL2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Angiopoietin-related protein 2(ANGPTL2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: WRDCLQALED GHDTSSIYLV KPENTNRLMQ VWCDQRHD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Angiopoietin-related protein 2(ANGPTL2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: angiopoietin like 2
Protein Name: Angiopoietin-related protein 2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human ANGPTL2 (275-312aa WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD), different from the related mouse sequence by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur ANGPTL2

Antigène: ANGPTL2 (Angiopoietin-Like 2 (ANGPTL2))

Autre désignation: ANGPTL2 (ANGPTL2 Produits)

Synonymes: anticorps ARP2, anticorps HARP, anticorps AI593246, anticorps AW260363, anticorps Arp2, anticorps ANGPTL2, anticorps angptl2, anticorps wu:fc41g02, anticorps arp2, anticorps fbnl, anticorps harp, anticorps angptl2a, anticorps angiopoietin like 2, anticorps angiopoietin-like 2, anticorps angiopoietin-like 2b, anticorps angiopoietin like 2 L homeolog, anticorps ANGPTL2, anticorps Angptl2, anticorps angptl2b, anticorps angptl2, anticorps angptl2.L

Sujet: Angiopoietin-related protein 2, also known as angiopoietin-like protein 2, is a protein that in humans is encoded by the ANGPTL2 gene. Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action.

Synonyms: AI593246 | Angptl2 | Arp2 | HARP | MGC8889 | UNQ170/PRO196 | Q9UKU9

ID gène: 23452