alpha Defensin 1 anticorps (C-Term)

N° du produit ABIN5518754

Détail du produit anti-alpha Defensin 1 anticorps

Antigène: alpha Defensin 1 (DEFA1) (Defensin, alpha 1 (DEFA1))

Épitope: AA 65-94, C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp alpha Defensin 1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Neutrophil defensin 1(DEFA1) detection. Tested with WB in Human,Rat.

Séquence: ACYCRIPACI AGERRYGTCI YQGRLWAFCC

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Neutrophil defensin 1(DEFA1) detection. Tested with WB in Human,Rat.
Gene Name: defensin alpha 1
Protein Name: Neutrophil defensin 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Alpha Defensin 1 (65-94aa ACYCRIPACIAGERRYGTCIYQGRLWAFCC).

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur alpha Defensin 1

Antigène: alpha Defensin 1 (DEFA1) (Defensin, alpha 1 (DEFA1))

Autre désignation: DEFA1 (DEFA1 Produits)

Synonymes: anticorps DEF1, anticorps DEFA2, anticorps HNP-1, anticorps HP-1, anticorps HP1, anticorps MRS, anticorps Defcr, anticorps Defcr1, anticorps DEFA1, anticorps Defa, anticorps Def, anticorps GB19392, anticorps defensin alpha 1, anticorps defensin, alpha 1, anticorps defensin alpha 5, anticorps alpha-defensin 1A, anticorps defensin 1, anticorps neutrophil defensin 1, anticorps DEFA1, anticorps Defa1, anticorps Defa5, anticorps MNP1A, anticorps Def1, anticorps LOC107973256

Sujet: Defensin, alpha 1, also known as human alpha defensin 1, human neutrophil peptide 1 (HNP-1) or neutrophil defensin 1 is a human protein that is encoded by the DEFA1 gene. Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 3 by only one amino acid. This gene and the gene encoding defensin, alpha 3 are both subject to copy number variation.

Synonyms: DEF1 | DEFA1 | DEFA1B | DEFA2 | Defensin 1 | Defensin | HNP-1 | HNP-2 | HNP1 | HP-1 | HP-2 | HP1 | HP2 | MRS | P59665

ID gène: 1667

UniProt: P59665

Pathways: Cellular Response to Molecule of Bacterial Origin