HMGB1 anticorps (C-Term)

N° du produit ABIN5518759

Détail du produit anti-HMGB1 anticorps

Antigène: HMGB1 (High Mobility Group Box 1 (HMGB1))

Épitope: AA 124-154, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HMGB1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for High mobility group protein B1(HMGB1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: DVAKKLGEMW NNTAADDKQP YEKKAAKLKE K

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for High mobility group protein B1(HMGB1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: high mobility group box 1
Protein Name: High mobility group protein B1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-HMGB1 (ABIN5518759)

Jia, Sun, Hu, Li, Ruan: "Propofol inhibits the release of interleukin-6, 8 and tumor necrosis factor-α correlating with high-mobility group box 1 expression in lipopolysaccharides-stimulated RAW 264.7 cells." dans: BMC anesthesiology, Vol. 17, Issue 1, pp. 148, (2018) (PubMed).

Ruisong, Xiaorong, Gangying, Chunfeng, Changjiang, Xuefei, Yuanhong, Hong: "The Protective Role of Interleukin-33 in Myocardial Ischemia and Reperfusion Is Associated with Decreased HMGB1 Expression and Up-Regulation of the P38 MAPK Signaling Pathway." dans: PLoS ONE, Vol. 10, Issue 11, pp. e0143064, (2016) (PubMed).

Li, Zhou, Zhou, Zou: "Galantamine protects against lipopolysaccharide-induced acute lung injury in rats." dans: Brazilian journal of medical and biological research = Revista brasileira de pesquisas medicas e biologicas, Vol. 49, Issue 2, pp. e5008, (2016) (PubMed).

Bi, Zhu, Yan, Chen, Wang, Ma, Yang: "Association of Upregulated HMGB1 and c-IAP2 Proteins With Hepatocellular Carcinoma Development and Progression." dans: Hepatitis monthly, Vol. 14, Issue 12, pp. e23552, (2015) (PubMed).

Détails sur HMGB1

Antigène: HMGB1 (High Mobility Group Box 1 (HMGB1))

Autre désignation: HMGB1 (HMGB1 Produits)

Synonymes: anticorps HMG1, anticorps HMG3, anticorps SBP-1, anticorps DEF, anticorps HMG-1, anticorps Hmg1, anticorps amphoterin, anticorps p30, anticorps hmgb1, anticorps ik:tdsubc_1a5, anticorps wu:fb23c02, anticorps xx:tdsubc_1a5, anticorps zgc:56110, anticorps zgc:77104, anticorps hmg-1, anticorps hmg3, anticorps sbp-1, anticorps hmg1, anticorps HMGB1, anticorps Ac2-008, anticorps high mobility group box 1, anticorps high-mobility group box 1, anticorps high mobility group box 1a, anticorps high mobility group box 1 L homeolog, anticorps high mobility group protein B1, anticorps HMGB1, anticorps Hmgb1, anticorps hmgb1, anticorps hmgb1a, anticorps hmgb1.L, anticorps LOC100359149

Sujet: High mobility group box 1 protein, also known as high-mobility group protein 1 (HMG-1) and amphoterin, is a protein that in humans is encoded by the HMGB1 gene. This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.

Synonyms: Amphoterin | HMG-1 | HMG1 | HMG3 | HMGB 1 | HMGB1 | SBP 1 | P09429

ID gène: 3146

UniProt: P09429

Pathways: Signalisation p53, Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development, Positive Regulation of Endopeptidase Activity, Regulation of Carbohydrate Metabolic Process, Toll-Like Receptors Cascades, Smooth Muscle Cell Migration, Inflammasome