IFNGR1 anticorps (C-Term)

N° du produit ABIN5518762

Détail du produit anti-IFNGR1 anticorps

Antigène: IFNGR1 (Interferon gamma Receptor 1 (IFNGR1))

Épitope: AA 443-484, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IFNGR1 est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS)

Fonction: Rabbit IgG polyclonal antibody for Interferon gamma receptor 1(IFNGR1) detection. Tested with WB, FCM in Human.

Séquence: QELITVIKAP TSFGYDKPHV LVDLLVDDSG KESLIGYRPT ED

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Interferon gamma receptor 1(IFNGR1) detection. Tested with WB, FCM in Human.
Gene Name: interferon gamma receptor 1
Protein Name: Interferon gamma receptor 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human IFNGR1 (443-484aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED), different from the related mouse sequence by seventeen amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Flow Cytometry: Concentration: 1-3 μg/1x106 cells, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur IFNGR1

Antigène: IFNGR1 (Interferon gamma Receptor 1 (IFNGR1))

Autre désignation: IFNGR1 (IFNGR1 Produits)

Synonymes: anticorps CD119, anticorps IFNGR, anticorps IFN-gammaR, anticorps Ifgr, anticorps Ifngr, anticorps Nktar, anticorps IFNGR1, anticorps MGC129098, anticorps ifngr1, anticorps MGC194858, anticorps MGC194873, anticorps zgc:194858, anticorps cd119, anticorps ifngr, anticorps DKFZp469K1232, anticorps interferon gamma receptor 1, anticorps cytokine receptor family member B17, anticorps IFNGR1, anticorps Ifngr1, anticorps crfb17, anticorps ifngr1

Sujet: Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.

Synonyms: CD 119 | CD119 | CDw119 | IFN gamma R1 | IFN-gamma-R1 | IFNG R1 | IFNGR 1 | IFNGR | IFNGR1 | IMD27A | IMD27B | P15260

ID gène: 3459

UniProt: P15260

Pathways: Interferon-gamma Pathway