Leptin Receptor anticorps (C-Term)
-
- Antigène Voir toutes Leptin Receptor (LEPR) Anticorps
- Leptin Receptor (LEPR)
-
Épitope
- AA 793-839, C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Leptin Receptor est non-conjugé
-
Application
- ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Leptin receptor(LEPR) detection. Tested with IHC-P, ELISA in Human,Mouse,Rat.
- Séquence
- KKYYIHDHFI PIEKYQFSLY PIFMEGVGKP KIINSFTQDD IEKHQSD
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Leptin receptor(LEPR) detection. Tested with IHC-P, ELISA in Human,Mouse,Rat.
Gene Name: leptin receptor
Protein Name: Leptin receptor - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human Leptin Receptor (793-839aa KKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQSD), different from the related mouse sequence by nine amino acids, and from the related rat sequence by eight amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product LEPR Anticorps primaire
-
-
- Indications d'application
-
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
The Influence of LepR Tyrosine Site Mutations on Mouse Ovary Development and Related Gene Expression Changes." dans: PLoS ONE, Vol. 10, Issue 11, pp. e0141800, (2016) (PubMed).
: "
-
The Influence of LepR Tyrosine Site Mutations on Mouse Ovary Development and Related Gene Expression Changes." dans: PLoS ONE, Vol. 10, Issue 11, pp. e0141800, (2016) (PubMed).
-
- Antigène
- Leptin Receptor (LEPR)
- Autre désignation
- LEPR (LEPR Produits)
- Synonymes
- anticorps CD295, anticorps LEP-R, anticorps LEPRD, anticorps OB-R, anticorps OBR, anticorps obr, anticorps cd295, anticorps ob-rb, anticorps Fa, anticorps LEPROT, anticorps Leprb, anticorps Modb1, anticorps OB-RGRP, anticorps Obr, anticorps db, anticorps diabetes, anticorps obese-like, anticorps obl, anticorps ObRb, anticorps Ob-R, anticorps Ob-RM, anticorps lepr, anticorps leptin receptor, anticorps leptin receptor S homeolog, anticorps LEPR, anticorps lepr, anticorps Lepr, anticorps lepr.S
- Sujet
-
Leptin receptor, also known as LEP-R or OB-R is a protein that in humans is encoded by the LEPR gene. The protein encoded by this gene belongs to the gp130 family of cytokine receptors that are known to stimulate gene transcription via activation of cytosolic STAT proteins. This protein is a receptor for leptin (an adipocyte-specific hormone that regulates body weight), and is involved in the regulation of fat metabolism, as well as in a novel hematopoietic pathway that is required for normal lymphopoiesis. Mutations in this gene have been associated with obesity and pituitary dysfunction. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Synonyms: CD295 | DB | OBR | Fa | Obr | HuB219 | LEP R | LEPR | LEP-R | LEPRD | LEPROT | Leptin receptor | OB R | OB receptor | OB-R | OBRGRP | OB-RGRP | P48357 - ID gène
- 3953
- UniProt
- P48357
- Pathways
- Signalistation JAK/STAT, AMPK Signaling, Feeding Behaviour
-