TUB anticorps (C-Term)
-
- Antigène Voir toutes TUB Anticorps
- TUB (Tubby Homolog (TUB))
-
Épitope
- AA 395-429, C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TUB est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Tubby protein homolog(TUB) detection. Tested with WB in Human.
- Séquence
- VHERVSIRPR NEHETLLARW QNKNTESIIE LQNKT
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Tubby protein homolog(TUB) detection. Tested with WB in Human.
Gene Name: tubby bipartite transcription factor
Protein Name: Tubby protein homolog - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human TUB 1 (395-429aa VHERVSIRPRNEHETLLARWQNKNTESIIELQNKT), different from the related mouse and rat sequences by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product TUB Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- TUB (Tubby Homolog (TUB))
- Autre désignation
- TUB (TUB Produits)
- Sujet
-
Tubby protein homolog is a protein that in humans is encoded by the TUB gene. This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene.
Synonyms: rd5 | TUB 1 | TUB | P50607 - ID gène
- 7275
- UniProt
- P50607
- Pathways
- Signalisation RTK, Sensory Perception of Sound
-