MSI1 anticorps (N-Term)

N° du produit ABIN5518855

Détail du produit anti-MSI1 anticorps

Antigène: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Épitope: AA 21-54, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MSI1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for RNA-binding protein Musashi homolog 1(MSI1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: KMFIGGLSWQ TTQEGLREYF GQFGEVKECL VMRD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for RNA-binding protein Musashi homolog 1(MSI1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: musashi RNA binding protein 1
Protein Name: RNA-binding protein Musashi homolog 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human Musashi 1/Msi1 (21-54aa KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur MSI1

Antigène: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Autre désignation: MSI1 (MSI1 Produits)

Synonymes: anticorps CG5099, anticorps DMSIDNA, anticorps Dmel\\CG5099, anticorps Msi, anticorps SIDNA, anticorps anon-EST:Liang-2.35, anticorps clone 2.35, anticorps Msi1h, anticorps Musashi, anticorps Musashi-1, anticorps Musashi1, anticorps XNrp-1, anticorps nrp-1B, anticorps Dsim\\GD21224, anticorps GD21224, anticorps dsim_GLEANR_4982, anticorps msi, anticorps musashi, anticorps Musahi1, anticorps m-Msi-1, anticorps msi1h, anticorps musashi, anticorps musashi RNA binding protein 1, anticorps GD21224 gene product from transcript GD21224-RD, anticorps musashi RNA-binding protein 1, anticorps musashi RNA binding protein 1 S homeolog, anticorps msi, anticorps msi1, anticorps Dsim\msi, anticorps MSI1, anticorps Msi1, anticorps msi1.S

Sujet: RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.

Synonyms: Msi 1 | Msi1 | Musashi-1 | Musashi1 | O43347

ID gène: 4440

UniProt: O43347

Pathways: Stem Cell Maintenance