TFPI2 anticorps (N-Term)
-
- Antigène Voir toutes TFPI2 Anticorps
- TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))
-
Épitope
- AA 70-105, N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TFPI2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Tissue factor pathway inhibitor 2(TFPI2) detection. Tested with WB, IHC-P in Human,Mouse.
- Séquence
- EGNANNFYTW EACDDACWRI EKVPKVCRLQ VSVDDQ
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Tissue factor pathway inhibitor 2(TFPI2) detection. Tested with WB, IHC-P in Human,Mouse.
Gene Name: tissue factor pathway inhibitor 2
Protein Name: Tissue factor pathway inhibitor 2 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human TFPI2 (70-105aa EGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQ).
- Isotype
- IgG
- Top Product
- Discover our top product TFPI2 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))
- Autre désignation
- TFPI2 (TFPI2 Produits)
- Synonymes
- anticorps MGC68843, anticorps TFPI2, anticorps MGC108301, anticorps si:ch211-262k23.2, anticorps tfpi2, anticorps PP5, anticorps REF1, anticorps TFPI-2, anticorps AV000670, anticorps PP5/TFPI-2, anticorps tissue factor pathway inhibitor 2 L homeolog, anticorps tissue factor pathway inhibitor 2, anticorps tfpi2.L, anticorps TFPI2, anticorps tfpi2, anticorps Tfpi2
- Sujet
-
Tissue factor pathway inhibitor 2, also known as TFPI2, is a human gene which is located at 7q22. It is an important regulator of the extrinsic pathway of blood coagulation through its ability to inhibit factor Xa and factor VIIa-tissue factor activity. After a 22-residue signal peptide, the mature TFPI2 protein contains 213 amino acids with 18 cysteines and 2 canonical N-linked glycosylation sites. The purified recombinant TFPI2 strongly inhibited the amidolytic activities of trypsin and the factor VIIa-tissue factor complex. The latter inhibition was markedly enhanced in the presence of heparin. Mouse TFPI2 mRNA is highly expressed in developing mouse placenta, as in human. And there are also high transcript levels in adult mouse liver and kidney.
Synonyms: Tissue factor pathway inhibitor 2 | TFPI-2 | Placental protein 5 | PP5 | TFPI2 | TFPI 2 | P48307 - ID gène
- 7980
- UniProt
- P48307
-