Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

EGFR anticorps (N-Term)

EGFR Reactivité: Humain, Souris, Rat WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN5518909
  • Antigène Voir toutes EGFR Anticorps
    EGFR (Epidermal Growth Factor Receptor (EGFR))
    Épitope
    • 39
    • 38
    • 38
    • 38
    • 28
    • 27
    • 27
    • 27
    • 26
    • 21
    • 21
    • 18
    • 17
    • 16
    • 16
    • 16
    • 15
    • 15
    • 15
    • 15
    • 14
    • 13
    • 13
    • 13
    • 11
    • 9
    • 8
    • 7
    • 7
    • 6
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    AA 25-57, N-Term
    Reactivité
    • 814
    • 334
    • 327
    • 26
    • 26
    • 24
    • 21
    • 15
    • 9
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 632
    • 186
    • 13
    • 11
    • 5
    • 1
    • 1
    Lapin
    Clonalité
    • 598
    • 246
    • 2
    Polyclonal
    Conjugué
    • 428
    • 63
    • 31
    • 25
    • 23
    • 22
    • 22
    • 21
    • 20
    • 20
    • 20
    • 15
    • 10
    • 10
    • 10
    • 10
    • 10
    • 10
    • 10
    • 10
    • 10
    • 8
    • 8
    • 5
    • 4
    • 4
    • 4
    • 4
    • 4
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp EGFR est non-conjugé
    Application
    • 567
    • 274
    • 158
    • 147
    • 126
    • 101
    • 96
    • 92
    • 81
    • 46
    • 37
    • 34
    • 33
    • 19
    • 11
    • 8
    • 6
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Fonction
    Rabbit IgG polyclonal antibody for Epidermal growth factor receptor(EGFR) detection. Tested with WB in Human,Mouse,Rat.
    Séquence
    LEEKKVCQGT SNKLTQLGTF EDHFLSLQRM FNN
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Epidermal growth factor receptor(EGFR) detection. Tested with WB in Human,Mouse,Rat.
    Gene Name: epidermal growth factor receptor
    Protein Name: Epidermal growth factor receptor
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the N-terminus of human EGFR (25-57aa LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNN), different from the related mouse sequence by two amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product EGFR Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    Notes: Tested Species: Species with positive results.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Stock
    4 °C,-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Hao, Yang, Ding, Guo, Zhu, Ji, Zhou, Wu: "Paeoniflorin Potentiates the Inhibitory Effects of Erlotinib in Pancreatic Cancer Cell Lines by Reducing ErbB3 Phosphorylation." dans: Scientific reports, Vol. 6, pp. 32809, (2018) (PubMed).

    Shangguan, Jiang, Pan, Xiao, Tan, Tie, Qin, Deng, Chen, Wang: "Glucocorticoid mediates prenatal caffeine exposure-induced endochondral ossification retardation and its molecular mechanism in female fetal rats." dans: Cell death & disease, Vol. 8, Issue 10, pp. e3157, (2018) (PubMed).

    Cheng, Li, Liu, Cheng, Ma, Qiu: "YC-1 exerts inhibitory effects on MDA-MB-468 breast cancer cells by targeting EGFR in vitro and in vivo under normoxic condition." dans: Chinese journal of cancer, Vol. 31, Issue 5, pp. 248-56, (2013) (PubMed).

    Salenius, Haapanen, Harju, Jokela, Riekkinen: "Late carotid restenosis: aetiologic factors for recurrent carotid artery stenosis during long-term follow-up." dans: European journal of vascular surgery, Vol. 3, Issue 3, pp. 271-7, (1989) (PubMed).

  • Antigène
    EGFR (Epidermal Growth Factor Receptor (EGFR))
    Autre désignation
    EGFR (EGFR Produits)
    Synonymes
    anticorps C-erb, anticorps CG10079, anticorps D-EGFR, anticorps D-Egf, anticorps DEGFR, anticorps DER, anticorps DER flb, anticorps DER/EGFR, anticorps DER/faint little ball, anticorps DER/top, anticorps DER/torpedo, anticorps DER1, anticorps DEgfr, anticorps Degfr, anticorps Der, anticorps DmHD-33, anticorps Dmel\\CG10079, anticorps EFG-R, anticorps EGF-R, anticorps EGFR, anticorps EGFr, anticorps EGfr, anticorps EK2-6, anticorps Egf, anticorps Egf-r, anticorps EgfR, anticorps El, anticorps Elp, anticorps Elp-1, anticorps Elp-B1, anticorps Elp-B1RB1, anticorps HD-33, anticorps TOP, anticorps Torpedo/DER, anticorps Torpedo/Egfr, anticorps c-erbB, anticorps d-egf-r, anticorps dEGFR, anticorps dEGFR1, anticorps dEgfr, anticorps der, anticorps egfr, anticorps flb, anticorps l(2)05351, anticorps l(2)09261, anticorps l(2)57DEFa, anticorps l(2)57EFa, anticorps l(2)57Ea, anticorps mor1, anticorps top, anticorps top/DER, anticorps top/flb, anticorps torpedo/Egfr, anticorps torpedo/egfr, anticorps EGFR12, anticorps EGFR15, anticorps egfr1, anticorps Erbb2, anticorps ERBB, anticorps ERBB1, anticorps HER1, anticorps PIG61, anticorps mENA, anticorps ErbB-1, anticorps Errp, anticorps 9030024J15Rik, anticorps AI552599, anticorps Erbb, anticorps Errb1, anticorps Wa5, anticorps wa-2, anticorps wa2, anticorps epidermal growth factor receptor, anticorps Epidermal growth factor receptor, anticorps epidermal growth factor receptor a (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian), anticorps EGFR, anticorps Egfr, anticorps egfra, anticorps egfr1, anticorps LOC5564544
    Sujet
    The epidermal growth factor receptor (EGFR, ErbB-1, HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. It is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). EGFR exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor α (TGFα). EGFR and its ligands are cell signaling molecules involved in diverse cellular functions, including cell proliferation, differentiation, motility, and survival, and in tissue development. Mutations that lead to EGFR overexpression (known as upregulation) or overactivity have been associated with a number of cancers, including lung cancer and glioblastoma multiforme. In this latter case a more or less specific mutation of EGFR, called EGFRvIII is often observed.

    Synonyms: Epidermal growth factor receptor, Proto-oncogene c-ErbB-1, Receptor tyrosine-protein kinase erbB-1, EGFR, ERBB, ERBB1, HER1
    ID gène
    1956
    UniProt
    P00533
    Pathways
    Signalisation NF-kappaB, Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Stem Cell Maintenance, Hepatitis C, Positive Regulation of Response to DNA Damage Stimulus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, EGFR Downregulation, S100 Proteins
Vous êtes ici:
Support technique