HOXB1 anticorps (C-Term)
-
- Antigène Voir toutes HOXB1 Anticorps
- HOXB1 (Homeobox B1 (HOXB1))
-
Épitope
- AA 176-220, C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HOXB1 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Homeobox protein Hox-B1(HOXB1) detection. Tested with WB in Human,Mouse,Rat.
- Séquence
- TARTFDWMKV KRNPPKTAKV SEPGLGSPSG LRTNFTTRQL TELEK
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Homeobox protein Hox-B1(HOXB1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: homeobox B1
Protein Name: Homeobox protein Hox-B1 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human HOXB1 (176-220aa TARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEK), different from the related mouse sequence by four amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product HOXB1 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- HOXB1 (Homeobox B1 (HOXB1))
- Autre désignation
- HOXB1 (HOXB1 Produits)
- Synonymes
- anticorps HCFP3, anticorps HOX2, anticorps HOX2I, anticorps Hox-2.9, anticorps Z-3, anticorps hoxb1, anticorps id:ibd3532, anticorps Ghox-lab, anticorps HOXB-1, anticorps XHox-b1, anticorps hox-2.9, anticorps hoxb-1, anticorps homeobox B1, anticorps homeobox B1a, anticorps homeo box B1, anticorps homeobox protein Hox-B1a, anticorps homeobox B1 L homeolog, anticorps HOXB1, anticorps Hoxb1, anticorps hoxb1a, anticorps LOC101062167, anticorps hoxb1.L
- Sujet
-
Homeobox protein Hox-B1 is a protein that in humans is encoded by the HOXB1 gene. This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.
Synonyms: Homeobox protein Hox-B1, Homeobox protein Hox-2I, HOXB1, HOX2I - ID gène
- 3211
- UniProt
- P14653
-