Relaxin 1 anticorps

N° du produit ABIN5519057

Détail du produit anti-Relaxin 1 anticorps

Antigène: Relaxin 1 (RLN1)

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Relaxin 1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Relaxin 1 detection. Tested with WB, IHC-P in Human,Rat.

Séquence: VAAKWKDDVI KLCGRELVRA QIAICGMSTW S

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Relaxin 1 detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: relaxin 1
Protein Name: Prorelaxin H1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence of human Relaxin 1 (VAAKWKDDVIKLCGRELVRAQIAICGMSTWS).

Isotype: IgG

Information d'application

Indications d'application: Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur Relaxin 1

Antigène: Relaxin 1 (RLN1)

Autre désignation: RLN1 (RLN1 Produits)

Synonymes: anticorps H1, anticorps H1RLX, anticorps RLXH1, anticorps bA12D24.3.1, anticorps bA12D24.3.2, anticorps Rln, anticorps rlx, anticorps RELAX, anticorps RLX1, anticorps RNL1, anticorps RLN1, anticorps RLX, anticorps relaxin 1, anticorps RLN1, anticorps Rln1

Sujet: Relaxin 1 is a member of relaxin-like peptide family. Relaxin gene maps to human chromosome 19 near D19Mit23. Relaxin is a peptide hormone produced by the corpora lutea of ovaries during pregnancy in many mammalian species, including man. Relaxin widens the pubic bone and facilitates labor, it also softens the cervix (cervical ripening), and relaxes the uterine musculature. However, its significance may reach much further. Relaxin affects collagen metabolism, inhibiting collagen synthesis and enhancing its breakdown by increasing matrix metalloproteinases. It also enhances angiogenesis and is a potent renal vasodilator.

Synonyms: Prorelaxin H1, Relaxin B chain, Relaxin A chain, RLN1

ID gène: 6013

UniProt: P04808