Integrin alpha 3a anticorps (Cytoplasmic Domain, N-Term, Non-phosphorylated)

N° du produit ABIN5618629

Détail du produit anti-Integrin alpha 3a anticorps

Antigène: Integrin alpha 3a

Épitope: Cytoplasmic Domain, N-Term, Non-phosphorylated

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Integrin alpha 3a est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro))

Specificité: Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit a3A

Réactivité croisée (Details): Human

Attributs du produit: Mouse monoclonal Integrin alpha 3A antibody

Immunogène: Integrin alpha 3A antibody was raised in Mouse using a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin as the immunogen.

Clone: 158A3

Isotype: IgG2a

Information d'application

Indications d'application: IHC: 1:100-1:200, WB: 1:100-1:1000

Restrictions: For Research Use only

Stockage

Buffer: Supplied in PBS containing 0.09 % sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C

Détails sur Integrin alpha 3a

Antigène: Integrin alpha 3a

Abstract: Integrin alpha 3a Produits