Integrin alpha 3b anticorps (Cytoplasmic Domain, N-Term)

N° du produit ABIN5621198

Détail du produit anti-Integrin alpha 3b anticorps

Antigène: Integrin alpha 3b

Épitope: Cytoplasmic Domain, N-Term

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Integrin alpha 3b est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro))

Specificité: Recognizes specifically the cytoplasmic domain of integrin subunit alpha3B which is present in microvascular structures in brain and heart

Réactivité croisée (Details): Human

Attributs du produit: Mouse monoclonal Integrin alpha 3B antibody

Immunogène: Integrin alpha 3B antibody was raised in Mouse using a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin as the immunogen.

Clone: 54B3

Isotype: IgG1

Information d'application

Indications d'application: IHC: 1:25-1:200, WB: 1:100-1:1000

Restrictions: For Research Use only

Stockage

Buffer: Supplied in PBS containing 0.09 % sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C

Détails sur Integrin alpha 3b

Antigène: Integrin alpha 3b

Abstract: Integrin alpha 3b Produits