DAO anticorps (AA 144-180)

N° du produit ABIN5646959

Détail du produit anti-DAO anticorps

Antigène: DAO (ABP1) (Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1))

Épitope: AA 144-180

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DAO est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 144-180 (STAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDR) from the human protein were used as the immunogen for the ABP1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ABP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur DAO

Antigène: DAO (ABP1) (Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1))

Autre désignation: ABP1 / Amiloride binding protein 1 (ABP1 Produits)

Synonymes: anticorps ABP, anticorps ABP1, anticorps DAO, anticorps DAO1, anticorps KAO, anticorps 1600012D06Rik, anticorps Abp1, anticorps abp1, anticorps si:ch211-286c5.2, anticorps zgc:154101, anticorps Abp, anticorps dao, anticorps amine oxidase, copper containing 1, anticorps amine oxidase, copper-containing 1, anticorps AOC1, anticorps Aoc1, anticorps aoc1

Sujet: The AOC1 encodes a metal-binding membrane glycoprotein that oxidatively deaminates putrescine, histamine, and related compounds. The encoded protein is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Catalyzes the degradation of compounds such as putrescine, histamine, spermine, and spermidine, substances involved in allergic and immune responses, cell proliferation, tissue differentiation, tumor formation, and possibly apoptosis. Placental DAO is thought to play a role in the regulation of the female reproductive function.

UniProt: P19801