Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

AGO1 anticorps (AA 376-409)

EIF2C1 Reactivité: Humain, Souris, Rat WB, IHC (p), FACS Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN5646975
  • Antigène Voir toutes AGO1 (EIF2C1) Anticorps
    AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))
    Épitope
    • 10
    • 4
    • 2
    • 2
    • 1
    • 1
    • 1
    AA 376-409
    Reactivité
    • 30
    • 16
    • 6
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 33
    • 1
    • 1
    • 1
    Lapin
    Clonalité
    • 32
    • 4
    Polyclonal
    Conjugué
    • 23
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp AGO1 est non-conjugé
    Application
    • 23
    • 12
    • 9
    • 7
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)
    Purification
    Antigen affinity purified
    Immunogène
    Amino acids 376-409 (EISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGR) from the human protein were used as the immunogen for the AGO1 antibody.
    Isotype
    IgG
  • Indications d'application
    Optimal dilution of the AGO1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells,IHC (FFPE): 1-2 μg/mL
    Restrictions
    For Research Use only
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Stock
    -20 °C
    Stockage commentaire
    After reconstitution, the AGO1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Antigène
    AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))
    Autre désignation
    AGO1 / Argonaute 1 (EIF2C1 Produits)
    Synonymes
    anticorps Ago, anticorps Ago-1, anticorps Ago1, anticorps CG6671, anticorps Dm Ago1, anticorps Dmel\\CG6671, anticorps MRE20, anticorps ago1, anticorps ago1-1, anticorps anon-WO0257455.29, anticorps dAGO1, anticorps dAgo1, anticorps l(2)04845, anticorps l(2)4845, anticorps l(2)k00208, anticorps l(2)k08121, anticorps GB12654, anticorps dsim_GLEANR_9718, anticorps DsimGD25729, anticorps GD25729, anticorps EIF2C1, anticorps EIF2C, anticorps GERP95, anticorps Q99, anticorps Eif2c1, anticorps ARGONAUTE 1, anticorps T1N15.2, anticorps T1N15_2, anticorps Argonaute-1, anticorps protein argonaute-2, anticorps argonaute 1, anticorps Argonaute 1, anticorps protein argonaute-1, anticorps argonaute 1, RISC catalytic component, anticorps argonaute RISC catalytic subunit 1, anticorps Stabilizer of iron transporter SufD / Polynucleotidyl transferase, anticorps AGO1, anticorps LOC552062, anticorps ago1, anticorps LOC659936, anticorps Dsim\AGO1, anticorps Ago1, anticorps LOC100386910, anticorps LOC100482671, anticorps LOC475337
    Sujet
    This gene encodes a member of the argonaute family of proteins, which associate with small RNAs and have important roles in RNA interference (RNAi) and RNA silencing. This protein binds to microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represses translation of mRNAs that are complementary to them. It is also involved in transcriptional gene silencing (TGS) of promoter regions that are complementary to bound short antigene RNAs (agRNAs), as well as in the degradation of miRNA-bound mRNA targets. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target, and that its mRNA could give rise to an additional C-terminally extended isoform by use of an alternative in-frame translation termination codon.
    UniProt
    Q9UL18
    Pathways
    Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Hormone Transport, Regulation of Actin Filament Polymerization, Stem Cell Maintenance, Ribonucleoprotein Complex Subunit Organization
Vous êtes ici:
Support technique