AGO1 anticorps (AA 376-409)

N° du produit ABIN5646975

Détail du produit anti-AGO1 anticorps

Antigène: AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))

Épitope: AA 376-409

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AGO1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Purification: Antigen affinity purified

Immunogène: Amino acids 376-409 (EISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGR) from the human protein were used as the immunogen for the AGO1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the AGO1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the AGO1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur AGO1

Antigène: AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))

Autre désignation: AGO1 / Argonaute 1 (EIF2C1 Produits)

Synonymes: anticorps Ago, anticorps Ago-1, anticorps Ago1, anticorps CG6671, anticorps Dm Ago1, anticorps Dmel\\CG6671, anticorps MRE20, anticorps ago1, anticorps ago1-1, anticorps anon-WO0257455.29, anticorps dAGO1, anticorps dAgo1, anticorps l(2)04845, anticorps l(2)4845, anticorps l(2)k00208, anticorps l(2)k08121, anticorps GB12654, anticorps dsim_GLEANR_9718, anticorps DsimGD25729, anticorps GD25729, anticorps EIF2C1, anticorps EIF2C, anticorps GERP95, anticorps Q99, anticorps Eif2c1, anticorps ARGONAUTE 1, anticorps T1N15.2, anticorps T1N15_2, anticorps Argonaute-1, anticorps protein argonaute-2, anticorps argonaute 1, anticorps Argonaute 1, anticorps protein argonaute-1, anticorps argonaute 1, RISC catalytic component, anticorps argonaute RISC catalytic subunit 1, anticorps Stabilizer of iron transporter SufD / Polynucleotidyl transferase, anticorps AGO1, anticorps LOC552062, anticorps ago1, anticorps LOC659936, anticorps Dsim\AGO1, anticorps Ago1, anticorps LOC100386910, anticorps LOC100482671, anticorps LOC475337

Sujet: This gene encodes a member of the argonaute family of proteins, which associate with small RNAs and have important roles in RNA interference (RNAi) and RNA silencing. This protein binds to microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represses translation of mRNAs that are complementary to them. It is also involved in transcriptional gene silencing (TGS) of promoter regions that are complementary to bound short antigene RNAs (agRNAs), as well as in the degradation of miRNA-bound mRNA targets. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target, and that its mRNA could give rise to an additional C-terminally extended isoform by use of an alternative in-frame translation termination codon.

UniProt: Q9UL18

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Hormone Transport, Regulation of Actin Filament Polymerization, Stem Cell Maintenance, Ribonucleoprotein Complex Subunit Organization