ACTN3 anticorps (AA 574-617)

N° du produit ABIN5647038

Détail du produit anti-ACTN3 anticorps

Antigène: ACTN3 (Actinin, alpha 3 (ACTN3))

Épitope: AA 574-617

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACTN3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids 574-617 (EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK from the human protein were used as the immunogen for the ACTN3 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ACTN3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ACTN3

Antigène: ACTN3 (Actinin, alpha 3 (ACTN3))

Autre désignation: ACTN3 (ACTN3 Produits)

Synonymes: anticorps CG8953, anticorps Dmel\\CG8953, anticorps ORF1, anticorps acta-3, anticorps dabp, anticorps ACTN2, anticorps actn3, anticorps actnl, anticorps zgc:63559, anticorps fb95c03, anticorps wu:fb95c03, anticorps wu:fc11d03, anticorps zgc:77243, anticorps actinin alpha 3 (gene/pseudogene), anticorps actinin alpha 3, anticorps alpha actinin 3, anticorps actinin alpha 3a, anticorps actinin alpha 3 (gene/pseudogene) L homeolog, anticorps alpha-actinin-3, anticorps actinin alpha 3b, anticorps ACTN3, anticorps Actn3, anticorps actn3a, anticorps actn3.L, anticorps actn3, anticorps LOC100439754, anticorps actn3b

Sujet: Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants, the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.

UniProt: Q08043

Pathways: Cell-Cell Junction Organization