TUB anticorps (AA 395-429)

N° du produit ABIN5647049

Détail du produit anti-TUB anticorps

Antigène: TUB (Tubby Homolog (TUB))

Épitope: AA 395-429

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TUB est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 395-429 (VHERVSIRPRNEHETLLARWQNKNTESIIELQNKT) from the human protein were used as the immunogen for the Tubby antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Tubby antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Tubby antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur TUB

Antigène: TUB (Tubby Homolog (TUB))

Autre désignation: Tubby (TUB Produits)

Synonymes: anticorps rd5, anticorps tubby, anticorps MGC79522, anticorps TUB, anticorps MGC80126, anticorps MGC84061, anticorps tub, anticorps tubby bipartite transcription factor, anticorps tubby bipartite transcription factor S homeolog, anticorps tub, anticorps TUB, anticorps tub.S, anticorps Tub

Sujet: Tubby protein homolog is a protein that in humans is encoded by the TUB gene. This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene.

UniProt: P50607

Pathways: Signalisation RTK, Sensory Perception of Sound