Cyclin T1 anticorps
-
- Antigène Voir toutes Cyclin T1 (CCNT1) Anticorps
- Cyclin T1 (CCNT1)
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Cyclin T1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity purified
- Immunogène
- Amino acids QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM from the human protein were used as the immunogen for the Cyclin T1 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product CCNT1 Anticorps primaire
-
-
- Indications d'application
- Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- Prior to reconstitution, store at 4°C. After reconstitution, the Cyclin T1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- Cyclin T1 (CCNT1)
- Autre désignation
- Cyclin T1 (CCNT1 Produits)
- Synonymes
- anticorps CG6292, anticorps Dmcyclin T, anticorps Dmel\\CG6292, anticorps ORE-14, anticorps P-TEFb, anticorps anon-74EFc, anticorps dT, anticorps p124, anticorps Cyclin-T1, anticorps ccnt, anticorps cyct1, anticorps CCNT, anticorps CYCT1, anticorps HIVE1, anticorps 2810478G24Rik, anticorps AI115585, anticorps CycT1, anticorps fi75b02, anticorps si:dkey-18f23.10, anticorps wu:fi75b02, anticorps Cyclin T, anticorps cyclin T1, anticorps cyclin T1 L homeolog, anticorps CycT, anticorps CCNT1, anticorps ccnt1, anticorps Ccnt1, anticorps ccnt1.L
- Sujet
- Cyclin-T1 is a protein that in humans is encoded by the CCNT1 gene. This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.
- UniProt
- O60563
-