NFIA anticorps (AA 180-224)

N° du produit ABIN5647218

Détail du produit anti-NFIA anticorps

Antigène: NFIA (Nuclear Factor I/A (NFIA))

Épitope: AA 180-224

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NFIA est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Purification: Antigen affinity purified

Immunogène: Amino acids 180-224 (AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS) from the human protein were used as the immunogen for the NFIA antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL,FACS: 1-3 μg/10^6 cells

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the NFIA antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur NFIA

Antigène: NFIA (Nuclear Factor I/A (NFIA))

Autre désignation: NFIA (NFIA Produits)

Synonymes: anticorps NFIA, anticorps CTF, anticorps NF-I/A, anticorps NF1-A, anticorps NFI-A, anticorps NFI-L, anticorps si:ch211-88d2.2, anticorps wu:fq27e07, anticorps zgc:158351, anticorps CNFI-A, anticorps cNFI-A3, anticorps 1110047K16Rik, anticorps 9430022M17Rik, anticorps NF1A, anticorps nuclear factor I A, anticorps nuclear factor I/A, anticorps NFIA, anticorps nfia, anticorps Nfia

Sujet: Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimericDNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.

UniProt: Q12857