RPS6 anticorps (AA 13-52)

N° du produit ABIN5647262

Détail du produit anti-RPS6 anticorps

Antigène: RPS6 (Ribosomal Protein S6 (RPS6))

Épitope: AA 13-52

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPS6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids 13-52 (QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI) from the human protein were used as the immunogen for the RPS6 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the RPS6 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the RPS6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur RPS6

Antigène: RPS6 (Ribosomal Protein S6 (RPS6))

Autre désignation: RPS6 (RPS6 Produits)

Synonymes: anticorps S6, anticorps rps6, anticorps rps6a, anticorps S6R, anticorps (Rp)S6, anticorps CG10944, anticorps DS6, anticorps Dmel\\CG10944, anticorps M(1)7BC, anticorps M(1)7C, anticorps RPS6, anticorps Rp S6, anticorps Rps6, anticorps air8, anticorps air[8], anticorps anon-WO02059370.61, anticorps hen, anticorps l(1)air8, anticorps l(1)air[8], anticorps l(1)hen, anticorps pp30, anticorps rpS6, anticorps wu:fa92e06, anticorps wu:fb64g06, anticorps zgc:92237, anticorps ribosomal protein S6, anticorps ribosomal protein S6 S homeolog, anticorps S6 ribosomal protein, anticorps Ribosomal protein S6, anticorps 30S ribosomal protein S6, anticorps 40S ribosomal protein S6, anticorps RPS6, anticorps rps6.S, anticorps LOC100135859, anticorps Rps6, anticorps RpS6, anticorps rps6, anticorps rps-6, anticorps LOC100533219

Sujet: Ribosomal protein S6 (rpS6) is a component of the 40S ribosomal subunit and is therefore thought to be involved in regulating translation. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. While the true function of rpS6 is currently under investigation, studies have shown that it is involved in the regulation of cell size, cell proliferation, and glucose homeostasis.

UniProt: P62753

Pathways: Carbohydrate Homeostasis, Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly