ARHGEF1 anticorps (AA 41-71)

N° du produit ABIN5647328

Détail du produit anti-ARHGEF1 anticorps

Antigène: ARHGEF1 (rho Guanine Nucleotide Exchange Factor (GEF) 1 (ARHGEF1))

Épitope: AA 41-71

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARHGEF1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids 41-71 (EQNSQFQSLEQVKRRPAHLMALLQHVALQFE) from the human protein were used as the immunogen for the ARHGEF1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ARHGEF1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ARHGEF1

Antigène: ARHGEF1 (rho Guanine Nucleotide Exchange Factor (GEF) 1 (ARHGEF1))

Autre désignation: ARHGEF1 (ARHGEF1 Produits)

Synonymes: anticorps arhgef1, anticorps cb473, anticorps zgc:158261, anticorps ARHGEF1, anticorps GEF1, anticorps LBCL2, anticorps LSC, anticorps P115-RHOGEF, anticorps SUB1.5, anticorps Lbcl2, anticorps Lsc, anticorps Rho guanine nucleotide exchange factor (GEF) 1a, anticorps Rho guanine nucleotide exchange factor 1, anticorps Rho guanine nucleotide exchange factor (GEF) 1, anticorps arhgef1a, anticorps ARHGEF1, anticorps arhgef1, anticorps Arhgef1

Sujet: Rho guanine nucleotide exchange factor 1, also called p115-RhoGEF, is a protein that in humans is encoded by the ARHGEF1 gene. Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

UniProt: Q92888

Pathways: Neurotrophin Signaling Pathway, Regulation of G-Protein Coupled Receptor Protein Signaling, Thromboxane A2 Receptor Signaling