ACCN1 anticorps (AA 112-147)
-
- Antigène Voir toutes ACCN1 Anticorps
- ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))
-
Épitope
- AA 112-147
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACCN1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity purified
- Immunogène
- Amino acids 112-147 (ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK from the human protein were used as the immunogen for the ACCN1 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product ACCN1 Anticorps primaire
-
-
- Indications d'application
- Western blot: 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the ACCN1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))
- Autre désignation
- ACCN1 / ASIC2 (ACCN1 Produits)
- Synonymes
- anticorps ACCN, anticorps ACCN1, anticorps ASIC2a, anticorps BNC1, anticorps BNaC1, anticorps MDEG, anticorps hBNaC1, anticorps ACIC2, anticorps Accn1, anticorps BNaC1a, anticorps Mdeg, anticorps BNC1k, anticorps MDEG1, anticorps MDEG2, anticorps accn1, anticorps zASIC2, anticorps acid sensing ion channel subunit 2, anticorps acid-sensing (proton-gated) ion channel 2, anticorps ASIC2, anticorps Asic2, anticorps asic2
- Sujet
- Amiloride-sensitive cation channel 1, neuronal, also known as ASIC2, is a protein that in humans is encoded by the ACCN1 gene. This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified.
- UniProt
- Q16515
- Pathways
- Sensory Perception of Sound
-