BAX anticorps (AA 17-48)

N° du produit ABIN5647494

Détail du produit anti-BAX anticorps

Antigène: BAX (BCL2-Associated X Protein (BAX))

Épitope: AA 17-48

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BAX est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids 17-48 (EQIMKTGALLLQGFIQDRAGRMGGEAPELALD) from the human protein were used as the immunogen for the Bax antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Bax antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL,FACS: 1-2 μg/10^6 cells

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Bax antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur BAX

Antigène: BAX (BCL2-Associated X Protein (BAX))

Autre désignation: Bax (BAX Produits)

Synonymes: anticorps BAX-ALPHA, anticorps bax-A, anticorps xBax, anticorps xlbax, anticorps BAX, anticorps bax, anticorps fj16e01, anticorps wu:fc50b10, anticorps wu:fj16e01, anticorps BCL2L4, anticorps zgc:112983, anticorps BCL2 associated X, apoptosis regulator, anticorps BCL2-associated X protein L homeolog, anticorps BCL2-associated X protein, anticorps bcl2-associated X protein, a, anticorps bcl2-associated X protein, b, anticorps BAX, anticorps bax.L, anticorps bax, anticorps baxa, anticorps Bax, anticorps baxb

Sujet: Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

UniProt: Q07812

Pathways: Signalisation p53, Signalisation PI3K-Akt, Apoptose, Caspase Cascade in Apoptosis, Positive Regulation of Endopeptidase Activity, Unfolded Protein Response