GJC1 anticorps (AA 91-131)

N° du produit ABIN5647534

Détail du produit anti-GJC1 anticorps

Antigène: GJC1 (Gap Junction Protein, gamma 1, 45kDa (GJC1))

Épitope: AA 91-131

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GJC1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids 91-131 (YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE) from the human protein were used as the immunogen for the GJC1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the GJC1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the GJC1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur GJC1

Antigène: GJC1 (Gap Junction Protein, gamma 1, 45kDa (GJC1))

Autre désignation: Connexin 45 / GJC1 (GJC1 Produits)

Synonymes: anticorps CX45, anticorps GJA7, anticorps cx45, anticorps gja7, anticorps MGC52735, anticorps GJD3, anticorps GJC1, anticorps C130009G16Rik, anticorps Cnx45, anticorps Cx45, anticorps Gja-7, anticorps Gja7, anticorps gap junction protein gamma 1, anticorps gap junction protein gamma 1 L homeolog, anticorps gap junction protein, delta 3, 31.9kDa, anticorps gap junction protein, gamma 1, anticorps Gap junction gamma-1 protein, anticorps GJC1, anticorps gjc1.L, anticorps GJD3, anticorps Gjc1, anticorps gjc1

Sujet: Gap junction gamma-1 protein (GJC1), also known as gap junction alpha-7 protein (GJA7) or connexin 45 (Cx45), is a protein that in humans is encoded by the GJC1 gene. The International Radiation Hybrid Mapping Consortium mapped the GJA7 gene to chromosome 17q21.31. This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell.

UniProt: P36383

Pathways: Cell-Cell Junction Organization