HMGB1 anticorps (AA 124-154)

N° du produit ABIN5647575

Détail du produit anti-HMGB1 anticorps

Antigène: HMGB1 (High Mobility Group Box 1 (HMGB1))

Épitope: AA 124-154

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HMGB1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids 124-154 (DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK) from the human protein were used as the immunogen for the HMGB1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the HMGB1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the HMGB1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur HMGB1

Antigène: HMGB1 (High Mobility Group Box 1 (HMGB1))

Autre désignation: HMGB1 (HMGB1 Produits)

Synonymes: anticorps HMG1, anticorps HMG3, anticorps SBP-1, anticorps DEF, anticorps HMG-1, anticorps Hmg1, anticorps amphoterin, anticorps p30, anticorps hmgb1, anticorps ik:tdsubc_1a5, anticorps wu:fb23c02, anticorps xx:tdsubc_1a5, anticorps zgc:56110, anticorps zgc:77104, anticorps hmg-1, anticorps hmg3, anticorps sbp-1, anticorps hmg1, anticorps HMGB1, anticorps Ac2-008, anticorps high mobility group box 1, anticorps high-mobility group box 1, anticorps high mobility group box 1a, anticorps high mobility group box 1 L homeolog, anticorps high mobility group protein B1, anticorps HMGB1, anticorps Hmgb1, anticorps hmgb1, anticorps hmgb1a, anticorps hmgb1.L, anticorps LOC100359149

Sujet: High mobility group box 1 protein, also known as high-mobility group protein 1 (HMG-1) and amphoterin, is a protein that in humans is encoded by the HMGB1 gene. This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.

UniProt: P09429

Pathways: Signalisation p53, Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development, Positive Regulation of Endopeptidase Activity, Regulation of Carbohydrate Metabolic Process, Toll-Like Receptors Cascades, Smooth Muscle Cell Migration, Inflammasome