LYN anticorps (AA 470-501)

N° du produit ABIN5647656

Détail du produit anti-LYN anticorps

Antigène: LYN (V-Yes-1 Yamaguchi Sarcoma Viral Related Oncogene Homolog (LYN))

Épitope: AA 470-501

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LYN est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids 470-501 (DELYDIMKMCWKEKAEERPTFDYLQSVLDDFY) were used as the immunogen for the LYN antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the LYN antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the LYN antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur LYN

Antigène: LYN (V-Yes-1 Yamaguchi Sarcoma Viral Related Oncogene Homolog (LYN))

Autre désignation: LYN (LYN Produits)

Synonymes: anticorps JTK8, anticorps p53Lyn, anticorps p56Lyn, anticorps lyn, anticorps LYN, anticorps AA407514, anticorps Hck-2, anticorps jtk8, anticorps lyn-A, anticorps CH73-38P6.3, anticorps zgc:92124, anticorps LYN proto-oncogene, Src family tyrosine kinase, anticorps v-yes-1 Yamaguchi sarcoma viral related oncogene homolog, anticorps tyrosine-protein kinase Lyn, anticorps LYN proto-oncogene, Src family tyrosine kinase L homeolog, anticorps LYN, anticorps lyn, anticorps Lyn, anticorps LOC100593961, anticorps lyn.L

Sujet: Tyrosine-protein kinase Lyn is a protein that in humans is encoded in humans by the LYN gene. It is mapped to 8q12.1. Lyn is a member of the Src family of protein tyrosine kinases. In various hematopoietic cells, Lyn has emerged as a key enzyme involved in the regulation of cell activation.Lyn has been described to have an inhibitory role in myeloid lineage proliferation.

UniProt: P07948

Pathways: Fc-epsilon Receptor Signaling Pathway, Hormone Transport, Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling, Integrin Complex, BCR Signaling