MC2R anticorps (AA 268-297)

N° du produit ABIN5647725

Détail du produit anti-MC2R anticorps

Antigène: MC2R (Melanocortin 2 Receptor (Adrenocorticotropic Hormone) (MC2R))

Épitope: AA 268-297

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MC2R est non-conjugé

Application: Western Blotting (WB)

Réactivité croisée (Details): Expected species reactivity: Human

Purification: Antigen affinity purified

Immunogène: Amino acids 268-297 (NAVIDPFIYAFRSPELRDAFKKMIFCSRYW) from the human protein were used as the immunogen for the MC2R antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the MC2R antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the MC2R antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur MC2R

Antigène: MC2R (Melanocortin 2 Receptor (Adrenocorticotropic Hormone) (MC2R))

Autre désignation: MC2 Receptor / ACTH Receptor (MC2R Produits)

Synonymes: anticorps ACTHR, anticorps ACTH-R, anticorps MC2-R, anticorps MC2R, anticorps MC2, anticorps melanocortin 2 receptor, anticorps MC2R, anticorps Mc2r, anticorps mc2r

Sujet: Melanocortin-2 receptor (MC2R), also known as ACTH receptor (ACTHR), is a member of the G protein-coupled receptor family. This gene is mapped to 18p11.2. MC2R is selectively activated by adrenocorticotropic hormone, whereas the other four melanocortin receptors recognize a variety of melanocortin ligands. Mutations in MC2R can result in familial glucocorticoid deficiency. Alternate transcript variants have been found for this gene.

UniProt: Q01718

Pathways: cAMP Metabolic Process