TMEM107 anticorps (AA 22-57)

N° du produit ABIN5647748

Détail du produit anti-TMEM107 anticorps

Antigène: TMEM107 (Transmembrane Protein 107 (TMEM107))

Épitope: AA 22-57

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM107 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids 22-57 (VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL) from the human protein were used as the immunogen for the TMEM107 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the TMEM107 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the TMEM107 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur TMEM107

Antigène: TMEM107 (Transmembrane Protein 107 (TMEM107))

Autre désignation: TMEM107 (TMEM107 Produits)

Synonymes: anticorps zgc:77926, anticorps MGC157051, anticorps GRVS638, anticorps PRO1268, anticorps 1110004B13Rik, anticorps 2810049P21Rik, anticorps transmembrane protein 107, anticorps Transmembrane protein 107, anticorps transmembrane protein 107 L homeolog, anticorps tmem107, anticorps TMEM107, anticorps Tmem107, anticorps Tsp_08866, anticorps tm107, anticorps tmem107.L

Sujet: Cilia are dynamic signaling organelles essential for developmental patterning, including left-right specification, skeletal formation, neural development, and organogenesis. TMEM107 is predicted to be critical for cilia formation and signaling in a subset of embryonic tissues. Based on an alignment of the TMEM107 sequence with the genomic sequence (GRCh38), the gene was mapped to chromosome 17p13.1.

UniProt: Q6UX40