DHODH anticorps (AA 132-173)
-
- Antigène Voir toutes DHODH Anticorps
- DHODH (Dihydroorotate Dehydrogenase (DHODH))
-
Épitope
- AA 132-173
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DHODH est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity purified
- Immunogène
- Amino acids 132-173 (RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTED) from the human protein were used as the immunogen for the DHODH antibody.
- Isotype
- IgG
- Top Product
- Discover our top product DHODH Anticorps primaire
-
anti-Dihydroorotate Dehydrogenase (DHODH) (AA 35-392) antibody
DHODH Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Dihydroorotate Dehydrogenase (DHODH) (AA 32-140) antibodyDHODH Reactivité: Humain WB, ELISA, IHC (p) Hôte: Souris Monoclonal 6E1 unconjugated
anti-Dihydroorotate Dehydrogenase (DHODH) antibodyDHODH Reactivité: Humain, Souris, Rat IHC Hôte: Lapin Polyclonal unconjugated
anti-Dihydroorotate Dehydrogenase (DHODH) (Internal Region) antibodyDHODH Reactivité: Humain, Souris, Rat WB, ELISA, IHC, ICC, IF Hôte: Lapin Polyclonal unconjugated
anti-Dihydroorotate Dehydrogenase (DHODH) (AA 132-173), (N-Term) antibodyDHODH Reactivité: Humain, Souris, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Dihydroorotate Dehydrogenase (DHODH) (C-Term) antibodyDHODH Reactivité: Humain, Souris, Rat, Chien, Cheval, Poisson zèbre (Danio rerio), Boeuf (Vache), Lapin, Cobaye, Saccharomyces cerevisiae WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Dihydroorotate Dehydrogenase (DHODH) (AA 166-194) antibodyDHODH Reactivité: Humain WB Hôte: Lapin Polyclonal RB40540 unconjugated
anti-Dihydroorotate Dehydrogenase (DHODH) (N-Term) antibodyDHODH Reactivité: Humain, Souris, Rat, Chien, Cheval, Poisson zèbre (Danio rerio), Boeuf (Vache), Lapin, Cobaye, Porc, Saccharomyces cerevisiae WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Dihydroorotate Dehydrogenase (DHODH) (Internal Region) antibodyDHODH Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Dihydroorotate Dehydrogenase (DHODH) (AA 241-395) antibodyDHODH Reactivité: Humain ELISA, IHC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
- Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the DHODH antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- DHODH (Dihydroorotate Dehydrogenase (DHODH))
- Autre désignation
- DHODH (DHODH Produits)
- Synonymes
- anticorps DHOdehase, anticorps POADS, anticorps URA1, anticorps 2810417D19Rik, anticorps AI834883, anticorps DDBDRAFT_0167009, anticorps DDBDRAFT_0185217, anticorps DDB_0167009, anticorps DDB_0185217, anticorps DHOD, anticorps DHODase, anticorps XFHB_12025, anticorps dhodh, anticorps dihydroorotate dehydrogenase (quinone), anticorps dihydroorotate dehydrogenase, anticorps dihydroorotate dehydrogenase (quinone) L homeolog, anticorps DHODH, anticorps Dhodh, anticorps pyrD, anticorps pyr4, anticorps Mrub_0263, anticorps Arnit_2124, anticorps Trad_2703, anticorps Ftrac_1484, anticorps Ndas_0799, anticorps Mesil_1876, anticorps Slip_0841, anticorps Spirs_1436, anticorps XFHB_RS12780, anticorps dhodh.L
- Sujet
- Dihydroorotate dehydrogenase is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.
- UniProt
- Q02127
- Pathways
- Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus
-
