SUB1 anticorps (AA 96-127)

N° du produit ABIN5647848

Détail du produit anti-SUB1 anticorps

Antigène: SUB1 (Activated RNA Polymerase II Transcriptional Coactivator p15 (SUB1))

Épitope: AA 96-127

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SUB1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids 96-127 (MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL) from the human protein were used as the immunogen for the PC4 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the PC4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur SUB1

Antigène: SUB1 (Activated RNA Polymerase II Transcriptional Coactivator p15 (SUB1))

Autre désignation: PC4 / Positive cofactor 4 (SUB1 Produits)

Synonymes: anticorps P15, anticorps PC4, anticorps p14, anticorps AI842364, anticorps P9, anticorps Pc4, anticorps Rpo2tc1, anticorps SUB1 homolog, transcriptional regulator, anticorps SUB1 homolog (S. cerevisiae), anticorps SUB1, anticorps Sub1

Sujet: Activated RNA polymerase II transcriptional coactivator p15, also known as Positive cofactor 4 (PC4) or SUB1 homolog, is a protein that in humans is encoded by the SUB1 gene. This gene is mapped to 5p13.3. The transcriptional cofactor PC4 is an ancient single-strand DNA (ssDNA)-binding protein that has a homologue in bacteriophage T5 where it is likely the elusive replicative ssDNA-binding protein. The recombinant PC4 is shown to function identically to the native protein through its interaction with TAFs.

UniProt: P53999