GRIN1/NMDAR1 anticorps
-
- Antigène Voir toutes GRIN1/NMDAR1 (GRIN1) Anticorps
- GRIN1/NMDAR1 (GRIN1) (Glutamate Receptor, Ionotropic, N-Methyl D-Aspartate 1 (GRIN1))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GRIN1/NMDAR1 est non-conjugé
-
Application
- Western Blotting (WB)
- Marque
- Picoband™
- Séquence
- FIEIAYKRHK DARRKQMQLA FAAVNVWRKN LQDRK
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
- Rabbit IgG polyclonal antibody for NMDAR1 detection. Tested with WB in Human,Mouse,Rat.
- Immunogène
- A synthetic peptide corresponding to a sequence of human NMDAR1 (FIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK).
- Top Product
- Discover our top product GRIN1 Anticorps primaire
-
-
- Indications d'application
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot, 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
-
Mechanisms responsible for the effect of median nerve electrical stimulation on traumatic brain injury-induced coma: orexin-A-mediated N-methyl-D-aspartate receptor subunit NR1 upregulation." dans: Neural regeneration research, Vol. 11, Issue 6, pp. 951-6, (2016) (PubMed).
: "
-
Mechanisms responsible for the effect of median nerve electrical stimulation on traumatic brain injury-induced coma: orexin-A-mediated N-methyl-D-aspartate receptor subunit NR1 upregulation." dans: Neural regeneration research, Vol. 11, Issue 6, pp. 951-6, (2016) (PubMed).
-
- Antigène
- GRIN1/NMDAR1 (GRIN1) (Glutamate Receptor, Ionotropic, N-Methyl D-Aspartate 1 (GRIN1))
- Autre désignation
- GRIN1 (GRIN1 Produits)
- Synonymes
- anticorps GluN1, anticorps MRD8, anticorps NMDA1, anticorps NMDAR1, anticorps NR1, anticorps nmda1, anticorps nmdar1, anticorps GB19253, anticorps GRIN1, anticorps NMD-R1, anticorps Z16, anticorps GluRdelta1, anticorps GluRzeta1, anticorps M100174, anticorps Nmdar, anticorps Rgsc174, anticorps NMDAR1.1, anticorps zgc:152678, anticorps glutamate ionotropic receptor NMDA type subunit 1, anticorps glutamate receptor, ionotropic, N-methyl D-aspartate 1 S homeolog, anticorps NMDA receptor 1, anticorps G protein-regulated inducer of neurite outgrowth 1, anticorps glutamate receptor, ionotropic, NMDA1 (zeta 1), anticorps glutamate receptor, ionotropic, N-methyl D-aspartate 1a, anticorps GRIN1, anticorps grin1.S, anticorps grin1, anticorps Grin1, anticorps Nmdar1, anticorps Gprin1, anticorps grin1a
- Sujet
-
Synonyms: Glutamate receptor ionotropic, NMDA 1, GluN1, Glutamate [NMDA] receptor subunit zeta-1, N-methyl-D-aspartate receptor subunit NR1, NMD-R1, GRIN1, NMDAR1
Background: Glutamate [NMDA] receptor subunit zeta-1 is a protein that in humans is encoded by the GRIN1 gene. The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described.
- UniProt
- Q05586
- Pathways
- Synaptic Membrane, Feeding Behaviour, Regulation of long-term Neuronal Synaptic Plasticity
-