STAR anticorps
-
- Antigène Voir toutes STAR Anticorps
- STAR (Steroidogenic Acute Regulatory Protein (STAR))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp STAR est non-conjugé
-
Application
- Western Blotting (WB)
- Marque
- Picoband™
- Séquence
- EETLYSDQEL AYLQQGEEAM QKALGILSNQ EGWKKESQQD
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
- Rabbit IgG polyclonal antibody for StAR detection. Tested with WB in Human,Mouse,Rat.
- Immunogène
- A synthetic peptide corresponding to a sequence of human StAR (EETLYSDQELAYLQQGEEAMQKALGILSNQEGWKKESQQD).
- Top Product
- Discover our top product STAR Anticorps primaire
-
-
- Indications d'application
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot,0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- STAR (Steroidogenic Acute Regulatory Protein (STAR))
- Autre désignation
- STAR (STAR Produits)
- Synonymes
- anticorps STARD1, anticorps AV363654, anticorps D8Ertd419e, anticorps star, anticorps LOC100219165, anticorps StARD1, anticorps steroidogenic acute regulatory protein, anticorps steroidogenic acute regulatory protein L homeolog, anticorps STAR, anticorps Star, anticorps star, anticorps star.L
- Sujet
-
Synonyms: Steroidogenic acute regulatory protein, mitochondrial, StAR, START domain-containing protein 1, StARD1, STAR, STARD1
Tissue Specificity: Expressed in gonads, adrenal cortex and kidney.
Background: The steroidogenic acute regulatory protein, commonly referred to as StAR (STARD1), is a transport protein. This protein plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. It permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13.
- UniProt
- P49675
- Pathways
- Metabolism of Steroid Hormones and Vitamin D, Response to Growth Hormone Stimulus, C21-Steroid Hormone Metabolic Process, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis
-