DC-SIGN/CD209 anticorps
-
- Antigène Voir toutes DC-SIGN/CD209 (CD209) Anticorps
- DC-SIGN/CD209 (CD209) (CD209)
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DC-SIGN/CD209 est non-conjugé
-
Application
- Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))
- Marque
- Picoband™
- Séquence
- MSDSKEPRLQ QLGLLEEEQL RGLGFRQTRG YKSLA
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
- Rabbit IgG polyclonal antibody for DC-SIGN detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.
- Immunogène
- A synthetic peptide corresponding to a sequence of human DC-SIGN (MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA).
- Top Product
- Discover our top product CD209 Anticorps primaire
-
-
- Indications d'application
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.
Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL
Immunohistochemistry(Frozen Section), 0.5-1 μg/mL, Human
Immunocytochemistry, 0.5-1 μg/mL, Human
Flow Cytometry, 1-3 μg/1x106 cells, Human - Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- DC-SIGN/CD209 (CD209) (CD209)
- Autre désignation
- CD209 (CD209 Produits)
- Synonymes
- anticorps CDSIGN, anticorps CLEC4L, anticorps DC-SIGN, anticorps DC-SIGN1, anticorps cd209, anticorps CLEC4M, anticorps si:ch211-224h1.3, anticorps CD209, anticorps CIRE, anticorps Dcsign, anticorps SIGN-R1, anticorps SIGNR5, anticorps Cd209, anticorps CD209 molecule, anticorps CD209a antigen, anticorps CD209 antigen-like protein D, anticorps CD209c molecule, anticorps CD209 antigen, anticorps CD209, anticorps cd209, anticorps Cd209a, anticorps LOC100529184, anticorps Cd209c, anticorps LOC100460708, anticorps LOC105484282
- Sujet
-
Synonyms: CD209 antigen, C-type lectin domain family 4 member L, Dendritic cell-specific ICAM-3-grabbing non-integrin 1, DC-SIGN, DC-SIGN1, CD209, CD209, CLEC4L
Tissue Specificity: Predominantly expressed in dendritic cells and in DC-residing tissues. Also found in placental macrophages, endothelial cells of placental vascular channels, peripheral blood mononuclear cells, and THP-1 monocytes.
Background: DC-SIGN (Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Non-integrin) also known as CD209 (Cluster of Differentiation 209) is a protein which in humans is encoded by the CD209 gene. This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene. DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.
-