CEP68 anticorps
-
- Antigène Voir toutes CEP68 Anticorps
- CEP68 (Centrosomal Protein 68kDa (CEP68))
- Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CEP68 est non-conjugé
-
Application
- Western Blotting (WB)
- Marque
- Picoband™
- Séquence
- ELICWLYNVA DVTDHGTAAR SNLTSLKSSL QLYRQFKKDI D
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
- Rabbit IgG polyclonal antibody for CEP68 detection. Tested with WB in Human,Mouse,Rat.
- Immunogène
- A synthetic peptide corresponding to a sequence of human CEP68 (ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID).
- Top Product
- Discover our top product CEP68 Anticorps primaire
-
-
- Indications d'application
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot, 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- CEP68 (Centrosomal Protein 68kDa (CEP68))
- Autre désignation
- CEP68 (CEP68 Produits)
- Sujet
-
Synonyms: Centrosomal protein of 68 kDa, Cep68, CEP68, KIAA0582
Background: Centrosomal protein of 68 kDa is a protein that in humans is encoded by the CEP68 gene. It is mapped to chromosome 2. CEP68 is required for centrosome cohesion. It decorates fibres emanating from the proximal ends of centrioles. CEP68 and rootletin depend both on each other for centriole association, and both also require CEP250 for their function.
- UniProt
- Q76N32
- Pathways
- SARS-CoV-2 Protein Interactome
-